KEGG   Mus musculus (mouse): 26918Help
Entry
26918             CDS       T01002                                 

Gene name
Ern2, Ern1, Ire1, Ire1b, ire1-beta, mIre1
Definition
(RefSeq) endoplasmic reticulum (ER) to nucleus signalling 2 (EC:2.7.11.1)
  KO
K11715  
serine/threonine-protein kinase/endoribonuclease IRE2 [EC:2.7.11.1 3.1.26.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     26918 (Ern2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     26918 (Ern2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  IRE family
   26918 (Ern2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F3; 7 65.53 cM
AA seq 911 aa AA seqDB search
MARPVQRFQLWSPLGFLLQLVTLLGKLGPQVQSVRPESLLFVSTLDGSLHALNKQTGDLK
WTVKDDPIIQGPMYVTEMAFLSDPADGSLYVLGTQKQQGLMKLPFTIPELVHASPCRSSD
GVFYTGRKQDAWFVVDPESGETQMTLTTEGLSTPQLFIGRTQYTVSMHDLRTPALRWNTT
YRRYSAPLLNGSPGKYMSHLTSCGMGLLLTVDPGSGIVLWTQDLGVPVTGIYTWHQDGLH
QLPHLTLARDTLHFLVLRWGHIRLPASSYQDTATQFSSLDTQLLMTLYVGKEEAGFYVSK
ALVHAGVALVPRGLTLAPMDGPTTDEVTLQVSGEREGSPSTAVRYPSGSVALPSQWLLIG
YHEPPPVLHTTMLRVHPIPGKVSAETRASEDLHAPPVFFELLNLRREDPELHPEEKASDS
YPGLGSQDLLAATFTAILLGAWVLYLMRQQQQSPSAPAGPPDLSQDAQGQLSRDILQDQR
RFQSPSEPAQPPHDPEAGQPTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRLLR
ECFGLVRREVQLLQESDRHPNVLRYFCTEHGPQFHYIALELCQASLQEYVESPDLDRWGL
EPTTVLQQMMSGLAHLHSLHIVHRDLKPANILMAGPDSQGQGRVVISDFGLCKKLPVGRC
SFSLHSGIPGTEGWMAPELLQLPPDSPTSAVDIFSAGCVFYYVLSGGSHPFGESLYRQAN
ILSGDPCLAQLQEETHDKVVALDLVRAMLSLLPQDRPSAGWVLAHPLFWSRAKELQFFQD
VSDWLEKEPDQGPLVSALEAGSYKVVREDWHKHISAPLQADLKRFRSYKGTSVRDLLRAM
RNKKHHYRELPAEVRQTLGQLPAGFIQYFTQRFPRLLLHTHRAMRTCASESLFLPYYPPA
LEARRPDATKS
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaccagtccagagatttcaactgtggtctcctctcgggttcctgctgcagctt
gtgacgttgctggggaaactcggtccacaggtccagtctgtcaggccagagagccttctg
tttgtgtctaccttggacggaagtctccatgcactgaacaagcagacaggggacttgaag
tggacagtgaaggatgaccccatcatccagggcccaatgtatgtcacagaaatggccttt
ctctctgacccagctgacggcagcctgtatgtcttgggaacccagaaacaacaggggctg
atgaaactgccattcaccatcccagagctggttcatgcctctccctgtcgcagctctgat
ggtgtcttctacacaggccggaagcaggatgcctggtttgtagtggaccctgagtcaggg
gagactcagatgacactgaccacagaaggcctctctactcctcaacttttcattggccga
acacagtacacagtctccatgcatgacctacggaccccagccctgcggtggaacacaacc
tatcgccgctactcagcacccctcctgaatggctcacccgggaaatacatgagccacctg
acatcctgtgggatgggcctgcttctcactgtggatccaggaagtggaattgtgctgtgg
acacaggacctgggagtgcctgtgacagggatttacacatggcaccaggatggtctgcac
cagctgccccatctcacactggctcgggacaccctacatttccttgtcctccgctggggc
cacatccgtcttcctgcctccagctaccaagacacagccacccagttctcttccttagac
acccagcttttgatgacactgtatgtggggaaagaagaagctgggttctatgtctctaaa
gcactggtccacgctggggtggccctcgtgccccgtggactgaccctggcacccatggac
ggtcccacaacagatgaggtgacacttcaagtctcgggggagcgagagggctcacccagc
actgctgtcagatacccctcaggcagcgtggccctccccagccagtggctactcattgga
taccacgaacctccccccgttctacacacaaccatgctgcgggttcatcccatcccaggg
aaagtgtctgctgagacacgagcctcagaggacctccatgctccacctgtcttttttgag
ctcctaaacctgaggagggaggatccagaactacatcctgaagagaaagcttcagactct
tatccagggctgggatcccaagacctgctagcagctaccttcactgccatcctcctggga
gcctgggtcctctacctgatgaggcagcagcagcagagcccttcagcacctgctggccct
cctgacctctcacaggatgctcagggacagctctcaagggacatcttacaggaccagagg
agatttcaaagcccctcagagccagcccagccacctcatgaccctgaagcagggcagccc
accgtggtggggaagatttccttcaaccccaaggatgtgctgggccgtggggcaggaggg
acttttgttttccgaggacagtttgaggggcgggcagtagctgtgaagaggctcctccga
gagtgctttggcttggttcggcgagaggtgcagctgctgcaagagtctgaccggcacccc
aacgtgcttcgctacttctgcactgagcatggtccccagttccactacattgccttggag
ctctgccaggcctccttgcaagagtacgtggagagcccagacctagatcgctggggcctg
gagcccaccacagtgctgcagcagatgatgtccggcctggcccatctacattccttacac
atagtacaccgtgacctaaagccagccaacattctcatggctgggcctgacagccagggc
caaggcagagtggtcatctctgacttcggcctctgcaagaagctacctgttggccgttgt
agcttcagtctccattctggtattcccggcacagaaggctggatggcaccagagctcctg
cagctccccccagacagcccgaccagcgctgtggatatcttctccgcaggctgcgtattt
tattacgtgctttccggtggcagccacccctttggagagagtctctaccgacaggccaac
atcctctcaggggatccctgtctggctcagctgcaggaagagacccatgacaaggttgtg
gcattggacttagtgagagccatgctgagcttgctgccccaggatcgcccctcggcagga
tgggtactggctcaccccctcttttggagcagagctaaggagctccagttcttccaggat
gtcagtgactggttggagaaggaaccagatcaggggcctctcgtgtcggcgctggaggca
ggaagctacaaggtggtccgggaagactggcacaagcacatctcagcccctctgcaggca
gatctgaaaaggttccgctcatacaaagggacatcagttcgagacctgctccgggccatg
aggaacaagaagcaccactacagggagctcccagctgaggtgcgccagacactaggccaa
cttcctgctggcttcattcagtacttcacacagcgattccccaggctgttgctgcacact
caccgtgccatgaggacctgcgcctctgagagcctcttcctgccctactacccaccagct
ctggaagccaggaggccagatgccacaaagagctga

DBGET integrated database retrieval system