KEGG   Mus musculus (mouse): 269209Help
Entry
269209            CDS       T01002                                 

Gene name
Stk36, 1700112N14Rik, B930045J24, FU, Fused, mKIAA1278
Definition
(RefSeq) serine/threonine kinase 36 (EC:2.7.11.1)
  KO
K06228  
fused [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Pathways in cancer
Basal cell carcinoma
Module
Hedgehog signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    269209 (Stk36)
   05217 Basal cell carcinoma
    269209 (Stk36)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     269209 (Stk36)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  ULK family [OT]
   269209 (Stk36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C3
AA seq 1316 aa AA seqDB search
MEKYHVLEMIGEGSFGRVYKGRKKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLWH
PNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHR
ILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHT
ADLWSVGCILYELAVGTPPFYTTSIFQLVSLILKDPVRWPSTISSCFKNFLQGLLTKDPR
QRLSWPDLLHHPFIAGRVTIITEPAGSDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR
ILRQACKLMAEEAKQKEDQNAGSALEQEDGLCKVTPSTAPVPGLKATPQESSLLAGILAS
EMKNNWEDWGAGEAPRTSRENHINLECEQGFPEPRPEAMGRQSTDVVDPENEEPDSDDEW
QRLLETSEPGPVQLKSPLTLLCNPDFCQRIQSQLRGTGEQILKGVLDGVSHLLPVLRILS
SLLSSCNDSVLLYSFCQEAGLPELPLSLLRYSQESSSIQQQPWYGALLRDLVAVVQAYFS
CTFNLERSQTGDSLQVFQEAASLFLDLLGKLLAQSDDSEQTFRRDSLMCFAVLCEAVDGN
SWAVSKAFYSSLLTTQRAVLDGLLHGLTVPQLPFHTPPGAPQVSQPLREQSEDVPGAISS
ALAAMCTAPVGLPSCWDAKEQVSWHLANQLTEDSSQLRPSLISGLRHHVLCLHLLKVLYA
CCYISERLCHILGQEPLALESLLMLVQGKVKVADWEESTEVALYLLSLLVFRLQDLPSGM
EKLGSEVATLFTHSHVVSLVNAAACLLGQLGQQGVTFDLQPREWIAAAAHALSAPAEVRL
TPPYSCGFYDGLLILLLQLLMQVQGKPGLIRDVVGSEVWTILWHRFSMALRLPEEVSAQE
DDLLLSSPSSLEPDWTLISPQGMAALLSLAMAIFTQESQLCLSHLSQHGSVLMLTLKHLL
SPSFLHHLSQAPQGPEFLPVVVLSVCKLLCFPFALDVDADLLVGVLADLRASEVVVCLLQ
VCCHHLSLLQAELPIGLLTRLALTDSASLKQFVNTVATSSRAIISFLSVVLLSDQPLMIS
DLLSLLTHTARILSPSHLSFIQELLSGSDESYRPLRSLLGHSENTVRVRAYGLLGHLLQH
SMALRGALQSQSGLLNLLLLGLGDKDPAVRRSASFAVGNAAYQAGPLGPALAAAVPSMTQ
LLGDAQDGIRRNAASALGNLGPEGLGKELLKCQVPQRLLEMACGDPQPTVKEAALIALRS
LQQESCIHQVLVSLGASEKLALLSLGNQLLPNSSNRPASVRHCRKLIQLLRPTHST
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtaccacgttttggagatgattggagaaggctcttttgggagagtgtataag
ggccgaaaaaaatacagtgctcaggtggtggccttgaagttcatccccaaactggggcgc
tcagagaaagagctgaggaatctgcaacgagagattgaaatcatgcggggtctgtggcat
cccaacattgtgcatatgctcgacagctttgagactgacaaagaggtggtggtggtgaca
gactacgctgaaggagaactctttcagattctggaagatgatggaaaacttcctgaagac
caggttcaggccatcgctgcccagttggtgtcagctctgtactacctgcattcccaccgc
atcctacaccgcgacatgaaaccgcagaacattcttctcgccaagggtggtggcattaaa
ctttgtgactttggattcgcccgagctatgagcaccaacaccatggtgctgacgtcgatc
aaaggcacaccgctctatatgtctccagagctggtggaggagcgaccatatgaccacacc
gcagacctctggtctgtgggctgcatcctgtatgagctggctgtcggcacgcctcccttc
tacaccaccagcatctttcagctggttagcctcattctcaaggaccctgtgcgctggccc
tccaccattagttcctgcttcaagaacttcttgcaggggctgctcaccaaggacccccgg
cagcgtctgtcctggccagacctcttacatcacccctttattgccggccgtgtcaccatc
ataactgaaccagcaggctccgatttgggcaccccatttactagtcgcctacccccagaa
cttcaggtcctcaaggatgaacaggcgcatcggctcgcacccaagggtaaccagtctcgc
atcctgcgccaggcctgtaaactcatggctgaagaagccaagcagaaggaagaccaaaat
gcaggatctgcccttgaacaagaagacgggctctgcaaggtgacacccagcacagccccc
gtgcctggactaaaggccactcctcaggagtcaagcctcttggctggtatactggcttca
gaaatgaagaacaactgggaagactggggggctggagaagcaccccgtacctctcgggaa
aaccacatcaacctggagtgtgaacaaggcttcccagagccgaggccagaggcgatgggc
cggcagagcactgatgtagtggatcctgaaaatgaggagccagacagtgatgatgagtgg
caacgcctactagagaccagcgagcctgggcctgtgcagctgaagtcccccctcaccctg
ttgtgtaaccctgacttctgccagcgcatccagagtcagctgcgcgggactggcgagcag
atcctgaaaggcgttctggatggtgtgtcccacctccttcctgtactccgcatcctgagt
agtctcctatccagctgcaatgactctgtgctcttgtattccttctgccaggaggcagga
ctgcctgagctgcctctcagccttcttaggtacagccaggagagtagcagcatccagcag
caaccttggtatggggcgctcttacgggacctggtggctgtggttcaggcctacttttcg
tgcaccttcaatctggagaggagccagacaggtgacagcctacaggtgtttcaggaggcc
gccagcctctttttggacctgttggggaagctgctggcccaatcagatgattccgagcag
acatttcgaagggatagccttatgtgctttgctgtcttgtgtgaagctgtggacggaaac
agctgggccgtctccaaagccttctactccagcctgttgaccacacagcgcgctgtgttg
gatggcctccttcacggcctgacagtcccacagcttcctttccacacaccaccaggagcc
ccacaagtgagccagccgctgcgggagcagagtgaagatgtacctggagccatctcttct
gccctggcagccatgtgtactgctcctgtggggctgcccagctgttgggatgccaaggag
caggtctcttggcatttggccaaccagctaactgaagacagcagccaactgaggccatcc
ctcatctctggtctgcgacaccatgtcctgtgcctccaccttctcaaggttctctacgcc
tgctgctatattagtgagcgcctgtgccatattctggggcaagagcccctggccttggag
tcgctgctgatgttagtccagggcaaggtgaaagtagcagattgggaagagtccactgag
gtggcactttacctcctgtcccttcttgtctttcggctccaagatctgccttcagggatg
gagaagctgggcagtgaggttgctactctctttacccactcacatgtcgtctctcttgtg
aatgcggcagcctgtctcttaggacagcttggtcagcaaggggtgacctttgacctccag
ccccgggaatggattgctgcagctgcacatgccttgtctgcccctgcagaggtccggctg
actccgccgtatagttgtggcttctatgatggcctcctcattctcctgcttcagcttctt
atgcaggtacaggggaagcctggcctgatcagggatgtggttggttcagaggtgtggacc
attctgtggcaccgcttttccatggccctgaggctgcccgaggaggtgtctgcccaggaa
gacgacctgctactatcaagtccctccagcctagagccagactggacactgatttcaccc
caaggcatggcagccttgctgagcctggccatggccatcttcacccaggagtcccagtta
tgcctgagccacctgtcccagcatggcagtgtcctcatgctgaccctgaagcacctgctt
tcacccagcttcttgcaccacctgagccaggcgccgcaggggcccgagtttctccccgtt
gtggtgctctccgtgtgcaagctgctctgcttcccttttgccctggatgtggatgctgac
ctccttgtaggtgtcttggctgacctcagggcctcggaagtggtagtctgcctgctgcag
gtctgctgccaccacctttcgttgttacaagcagagctgcccattggcctccttacacgc
ctggccctcacggattctgcctctctcaagcagtttgtgaacacagtggccacctcttct
agagccatcatctcattcctctctgttgttctcctgagtgaccagcccctcatgatctct
gacctcctgtccctgctgacacacacagcccggattctgtcccccagccacttgtccttt
atccaagagctcctgtctggctctgatgaatcctatcggccattgcgcagcctcctaggc
cactcagagaacactgtgcgggtccgtgcatatgggctcctgggacatttattacagcac
agcatggccctacgtggggcactacagagtcagtcaggactgctcaaccttctgctgcta
gggcttggagacaaggaccctgccgtgcgacgcagtgccagctttgctgtgggcaatgca
gcctaccaggctgggcctttgggacctgccttggcagctgcagtgcccagtatgacccag
ctgcttggagatgctcaggatgggatccggcgcaatgctgcatcagctctaggcaatctg
ggacctgaaggattgggcaaggagctattaaagtgccaagtaccccagcggctcctagaa
atggcatgtggagaccctcagccaactgtcaaagaggctgccctcattgcccttcgaagc
ctccaacaggagtcctgtattcatcaggtgctggtgtcgctgggtgccagtgagaagtta
gccttgctctctttggggaatcagttactgccgaatagcagcaacaggcctgcctccgtc
agacactgcaggaagctcatccaactcctgaggccaacccacagcacatga

DBGET integrated database retrieval system