KEGG   Mus musculus (mouse): 26921Help
Entry
26921             CDS       T01002                                 

Gene name
Map4k4, 9430080K19Rik, AU043147, AU045934, AW046177, HGK, Nik
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 (EC:2.7.11.1)
  KO
K04407  
mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26921 (Map4k4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     26921 (Map4k4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   26921 (Map4k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 B
AA seq 1234 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLHDHRRPHAQQQPPPPQQQDRSKPSFHAPEPKPHYDPADRAREVQWS
HLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEGLSQSSDSKSEVPEPTQK
AWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGGGQQNSQAGQRNSTSSIEPRLLWERV
EKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRVRSSSKSEGSPSPRQESAAKKPD
DKKEVFRPLKPAGEVDLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEEEDVEQEG
ADDSTSGPEDTRAASSPNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQTQSASS
TLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGLRPEAIRQDPTRKGSVVNVN
PTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRR
RFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVH
YKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELLHKPLLVDLTVEEGQRLK
VIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVN
TYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKF
LCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctcccgcgaagagcctggtggacattgacctgtcgtccctgcgggac
cctgctgggatttttgagctggtggaagtggttggaaatggcacctatggacaagtctat
aagggtcgacatgttaaaacgggtcagctggccgccatcaaggttatggacgtcaccgag
gatgaagaggaagaaatcaaactggagataaatatgctgaagaagtattctcatcatcga
aatattgccacgtactatggtgctttcattaagaagagccctccaggacatgatgaccaa
ctctggcttgttatggagttttgtggggctgggtccatcacagaccttgtgaagaacacc
aaagggaacactctcaaagaagactggattgcttacatctccagggaaatcctcagggga
ttggcacatctccatattcaccacgttattcaccgagatatcaagggccaaaatgtgctg
ctgaccgagaatgctgaggtgaaacttgttgattttggtgtaagcgctcagctggacagg
acggttggacggagaaatacgttcataggcacaccctactggatggctccagaggtcatc
gcctgtgatgagaacccagacgccacttacgactacagaagtgacctctggtcctgtggc
atcacagccatcgagatggctgaaggggccccccctctctgtgacatgcatccaatgaga
gcgctgtttctcatccccagaaaccctcctcccaggctgaagtcaaaaaaatggtcaaag
aaatttttcagctttatagaaggctgtctggtgaagaattacatgcagcggccctctaca
gagcaacttttaaaacaccctttcataagggatcagcccaatgaaaggcaggttcgaatc
cagcttaaggatcacatagaccggaccagaaagaagagaggcgagaaagatgagacggag
tacgagtacagcgggagcgaggaggaggaggaggaagtgcctgagcaggagggagagcca
agttccatcgtcaatgtgcctggagagtcaactctgcgacgtgatttcctgagactgcag
caggagaacaaggagcggtctgaggctctgcggagacagcagcttctgcaggagcagcag
ctccgggagcaggaggagtataagaggcagctgctggctgagaggcagaagcggattgaa
cagcagaaagaacagaggaggcggctggaagagcaacaaagaagagaacgggaagccagg
aggcagcaggagcgtgagcagcggcggcgtgaacaagaggagaagaggcgtctcgaggaa
ctggaaaggcggcgtaaagaagaggaagagaggagacgggcagaagaggagaagaggaga
gtggagagggaacaggagtacatcaggcggcagctagaggaggagcagcggcacctggag
atcctgcagcagcagctgctccaggagcaggccatgttactgcacgaccacaggaggccg
cacgcacagcagcagccgccgcccccgcagcagcaggacaggagcaaaccgagctttcat
gctccagagcccaagcctcactatgaccctgctgacagagctcgggaggtacagtggtcc
cacctggcatctctcaagaacaatgtctcccctgtctcgagatcccattccttcagtgac
ccttctcccaaattcgcacaccaccatctccgctctcaggacccatgtccaccttcccgc
agtgaggggctcagtcagagctctgactctaagtcggaggtgcccgagcccacccaaaag
gcttggtctagatcagacagtgacgaggtgcctccaagggttcccgtgagaacgacctct
cgttcccctgtcctctcccgtcgggattccccactgcagggcggtggacagcagaatagc
caagcaggacagagaaattccaccagcagtattgagccccggcttctttgggagagagtg
gaaaagctggtccccaggccaggcagtggcagctcttcagggtccagcaactcaggatcc
cagcctggctcccatcctgggtctcagagcggctccggtgaacgcttcagagtgagatca
tcatccaagtctgaaggttctccatcgccacgccaggaaagtgcagccaaaaagcctgac
gataagaaagaagtattccggcctctcaagcctgcgggagaagtggacttgactgcgttg
gccaaagagcttcgagcagtggaagatgttcggccacctcacaaagtaacagactactca
tcctccagtgaggagtctgggaccacagatgaggaggaggaggacgtggaacaggagggg
gctgatgattctacctcgggaccagaagacaccagagcagcgtcatctccgaacctgagc
aacggtgaaacagaatctgtgaaaacaatgatcgttcatgatgatgtagaaagtgagcca
gccatgaccccgtccaaggagggcaccctcatcgtccgccagactcagtccgctagtagc
acactccagaaacacaaatcttcctcctcctttacaccttttatagaccccaggttacta
cagatctctccatctagtgggacgacagtgacttccgtggtgggattttcctgtgatggg
ctgagaccagaagccataaggcaagatcctactcggaaaggctcagtggtcaatgtgaac
cccacgaacactaggccacagagtgatacccccgagattcgtaaatacaagaagagattt
aactcagagatcctgtgtgctgccttatggggagtgaacttgctggttggtacagagagc
ggtctgatgctcttggacagaagtggccaagggaaagtataccctctgatcagccgaaga
cggttccagcaaatggatgtgctcgaaggcctaaatgtcctggtgacaatatctggcaaa
aaggataagttacgtgtctactatttatcctggctaagaaataagattcttcataatgat
ccagaggttgagaagaagcaggggtggaccactgtgggcgacttggaagggtgcgtgcac
tataaagtcgtaaaatatgaaagaatcaagtttctggtaattgctttgaagagttctgtg
gaagtctatgcatgggcaccgaagccatatcacaaatttatggcctttaagtcatttgga
gaactgctacataagccattactggtggatctcactgtggaggaaggccagaggttgaaa
gtgatctatggatcctgtgcgggattccatgctgttgatgtggattcaggctcagtctat
gacatttatctaccaacacatattcagtgtagcatcaaaccccatgcaatcattatcctc
cccaacacggatgggatggagctgctggtgtgctacgaagacgagggggtttacgttaac
acgtacggaaggatcaccaaggacgtggttctgcagtggggagagatgccgacatctgta
gcatatatccggtcgaatcagacaatgggctggggagagaaggcaatagagatacgatct
gtggaaactggtcacttggatggtgtatttatgcacaaaagggctcagagactaaagttc
ctgtgtgaacgcaatgacaaggtgttctttgcctccgtccgctctggtggcagcagccag
gtctatttcatgaccttaggcaggacttctcttctgagctggtag

DBGET integrated database retrieval system