KEGG   Mus musculus (mouse): 269252Help
Entry
269252            CDS       T01002                                 

Gene name
Gtf3c4, 5330400C03, AI426938, AU014771, AU017413, KAT12, TFIIIC90
Definition
general transcription factor IIIC, polypeptide 4 (EC:2.3.1.48)
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     269252 (Gtf3c4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     269252 (Gtf3c4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 A3; 2
AA seq 676 aa AA seqDB search
MLDRMFNPEGKALPPMRGFKYTSWSPMGCDANGRCLLAALTMDNRLTVQVNLNRLQWVQL
VDLTEIYGDRLYETSYRLSKNEAPEGNLGDFAEFQRRHSMQTPVRMEWSSICTTQQVKHN
NECRDVSSVLLAVLFENGNIAVWQFQLPFVGKESISSCNTIESGISSPSVLFWWEYEHNN
RKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPVVLWKEMDKLPVHSIKCVPLYHPYQK
CSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHSLPIVSITADKQNGTVYTCSSDG
KVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGIAVSPCGAYLAIITTEGMMNGLHPVN
KNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLIDLVRWKILKDKHIPQFLHEALEKKI
ESSGVTYFWRFKLFLLRILYQSMQKSPSEALWKPTHEDSKILLVDSPGMGDGEDEQQEEG
TSKQGTKAGLQEKSKEGDTEETPEDSLTAGGDTGGREPVEEKLLEIQGKIEAVEMHLTRE
HMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDEDYDDRTAQVLIGHISKKMNKQTFPER
CSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARHPVPEDPDWI
KRLLQSPCPFCDSPVF
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgctagacaggatgttcaaccccgaggggaaggccttgcccccaatgcggggtttcaaa
tacactagctggtctccaatgggttgtgatgcaaatggcaggtgcctcttggcagcactg
accatggacaatcgcctgactgtgcaggtgaacctcaacagactccagtgggttcagctg
gttgatctgacggagatttatggagaccgtctttatgagactagttatagactgtctaaa
aatgaggctcctgagggaaatctcggggattttgctgagtttcagaggagacacagtatg
cagaccccagtcagaatggaatggtcgagtatctgtaccactcagcaggtcaagcacaac
aacgagtgccgggatgtgagcagcgtgctgctggctgtcctctttgagaacgggaatata
gctgtgtggcagttccagctgccattcgtggggaaggagtccatctcttcatgcaacact
attgagtcaggaatcagctcccccagtgttttgttttggtgggaatatgagcacaataat
aggaaaatgagtggccttattgtgggcagtgcttttggacctgtaaaaattctccctgtc
aatctcaaagcagtgaaaggctactttactttaaggcagcctgttgtcttgtggaaagaa
atggacaagttacctgtgcacagcatcaaatgtgtgccactttaccacccctaccagaag
tgtagctgtagcttagtggtagctgcaagaggctcctatgtgttttggtgtcttcttctg
atctccaaggcaggtctgaatgttcacaattcccacgtcacaggcctccactcactgccc
atcgtctccattactgcagacaagcagaatggaacagtgtacacctgctctagtgatggg
aaggtgaggcagttgattcccattttcacagatgttgcattaaagtttgaacaccagctg
attaagctctcagatgtctttggctcagtgaggactcacggcattgcagtgagtccctgt
ggtgcttatctggccatcatcaccactgagggcatgatgaatggcctccatcctgtgaat
aagaactaccaggtccagtttgttactctgaagacctttgaagaggcagctgctcagctc
ttggagtcttcagttcagaatctctttaagcaggtagacttgatcgacctggtccgctgg
aaaattttaaaagataaacatattcctcagtttttacatgaagcattggaaaaaaagatt
gaaagcagcggggttacctatttttggcgttttaagcttttccttctaaggattttgtat
cagtcaatgcagaaatccccttccgaggccttatggaaacccacccatgaggactcaaaa
atcttactggttgactcacctgggatgggcgacggtgaggatgagcagcaagaagaaggt
acttccaagcaggggactaaggctggcctgcaggagaagagcaaagaaggtgacacagag
gagacccctgaggactcactcactgcagggggagacaccggaggccgtgaacctgtagag
gaaaagctccttgagatccaagggaagattgaggctgtggagatgcacctgaccagggag
cacatgaagcgggtcctgggagaagtgtacctgcacacctggatcacagagaacaccagc
atacccaccagagggctctgtaacttcctgatgtctgatgaggattatgatgacaggaca
gcacaggtcttgattggacatatctccaagaagatgaacaaacagaccttccctgagcgc
tgcagtctgtgtaaggagatcttaccattcacagatcgcaagcaagctgtttgttccaat
gggcacatctggctccggtgctttctaacctaccagtcctgccagagcttgatatacaga
cggtgtttgctccatgacagcatcgccaggcatcctgttccagaagatcctgactggatt
aagaggttgctgcagagtccttgtcctttctgtgattctcctgtcttctga

DBGET integrated database retrieval system