KEGG   Mus musculus (mouse): 26941Help
Entry
26941             CDS       T01002                                 

Gene name
Slc9a3r1, EBP-50, NHE-RF, NHERF-1, NHERF1
Definition
(RefSeq) solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1
  KO
K13365  
Na(+)/H(+) exchange regulatory cofactor NHE-RF1
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   26941 (Slc9a3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E2
AA seq 355 aa AA seqDB search
MSADAAAGEPLPRLCCLEKGPNGYGFHLHGEKGKVGQFIRLVEPGSPAEKSGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDERLKKLGVSIREELLRPQEKSEQA
EPPAAADTHEAGDQNEAEKSHLRELRPRLCTMKKGPNGYGFNLHSDKSKPGQFIRAVDPD
SPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIKGGGDEAKLLVVDKETDEFFKKCKVI
PSQEHLDGPLPEPFSNGEIQKESSREALVEPASESPRPALARSASSDTSEELNSQDSPKR
QVSTEPSSTSSSSSDPILDLNISLAVAKERAHQKRSSKRAPQMDWSKKNELFSNL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggacgcagcggccggggagcctctgccccggctctgctgcctggagaagggt
ccaaatggctacggcttccacctgcacggggagaagggcaaggtgggccagtttatccgt
ctggtagaacctggctcgccggccgagaagtcggggttgttggctggagaccgattggtg
gaggtgaacggtgagaatgtggagaaggagacgcatcagcaggtggtgagccgcatccgc
gcagcgctgaacgccgtgcgcctgctggtggtcgacccggagaccgacgagcgtctcaag
aagctgggcgtctcgatccgggaagagctgctgcgcccccaggagaagtccgaacaagcc
gagcctccagcggccgccgacactcatgaggctggggaccagaatgaggccgaaaagagc
cacttgcgcgagctccggccccggctctgcaccatgaagaaaggccccaatggctatggc
ttcaacctgcacagcgacaagtctaagccaggccagttcatccgagcagtggacccagac
tcaccggcggaggcgtctggactccgggcccaggaccgaattgtggaggtcaatggtgtc
tgcatggagggcaagcagcacggggacgtggtgtccgccatcaagggtggaggtgatgag
gccaagctgctggtggtagacaaggaaacagatgagttcttcaagaagtgcaaagtgatc
ccatcccaggagcacctggatggccccttgcctgagcccttcagcaatggagagatacag
aaggagagcagccgtgaagccctggtggagccagcttcagagagccccaggccagccctg
gcaagatctgcctccagcgataccagtgaggagctaaattcccaagacagccccaagaga
caagtttccacagagccctcatctacctcctcctcctcctctgaccccatcttggacctc
aacatctccttggctgtggctaaagagagggcccaccagaagcgcagtagcaagagggcc
ccgcagatggactggagcaagaaaaatgaactcttcagcaacctctga

DBGET integrated database retrieval system