KEGG   Mus musculus (mouse): 26946Help
Entry
26946             CDS       T01002                                 

Gene name
Trpc7, TRP7, Trrp8
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 7 (EC:3.6.1.13)
  KO
K04970  
transient receptor potential cation channel subfamily C member 7
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   26946 (Trpc7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13; 13 B2
AA seq 862 aa AA seqDB search
MLGSNTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVR
KMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVR
IVEAILSHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIV
HILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVL
TALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNLQVW
SDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSI
GLPFLAIAYWIAPCSKLGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNET
FTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLS
IFVASFTARFMAFLKASEAQLYVDQYVQDVTLHNVSLPPEVAYFTYARDKWWPSDPQIIS
EGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNL
YSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTM
VVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYY
LIMRIKMCLIELCQSKAKRCENDLEMGMLNSKFRKTRYQAGMRNSENLTANSTFSKPTRY
QKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQ
LSEKFGKNLNKDHLRVNQGKDI
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgttggggagcaacaccttcaaaaacatgcagcgccggcacaccaccttgagggagaag
gggcgccgccaggccatccggggtcctgcctacatgttcaacgagaagggcacgagcctg
acccctgaggaggagcgcttcctggactcggctgagtatggcaacataccagtggtcaga
aaaatgctggaggaatccaagaccctcaatttcaactgcgtggactacatggggcagaac
gcgctgcagctggccgtgggcaacgagcacttggaggtcactgaactgttgctgaagaaa
gagaacttggcgcgggtgggcgacgcgctgctgctggccatcagcaagggctatgtgcgc
attgtggaggccatcctcagccatccggccttcgcgcagggccagcgcctgacgctcagc
ccgctggagcaggagctgcgggatgatgacttctatgcctacgacgaggatggcacgcgc
ttctcccacgacatcacacccatcatcctggcggcccactgccaggagtatgagattgtg
catatcttgctgctcaagggtgcgcgcattgagcggccccatgactacttctgcaagtgc
aatgagtgcacggagaagcagcgcaaggactccttcagtcactcgcgctcccggatgaat
gcctacaaaggactggccagtgccgcctacctgtccctatccagtgaagaccctgtcctc
actgcgctggagctaagcaacgagttagcccgactggccaacattgagactgaatttaag
aatgattacaggaagttatctatgcaatgcaaggattttgtggtgggcgtgctggacctg
tgccgagacacagaagaggtggaagcaattttaaatggcgatgtgaacttgcaagtctgg
tccgaccaccaccgtccaagtctgagccgaatcaaactcgccattaagtacgaagtcaag
aagttcgttgctcaccctaactgtcagcagcaattgcttaccatgtggtatgaaaatctc
tcaggcttacggcaacagtctatcgctgtgaaattcctggctgtctttggagtctccata
ggcctcccttttctcgccatagcctattggattgctccgtgcagcaagctaggacaaacc
ctgaggagccctttcatgaagtttgtggcccatgcagtgtcttttaccatcttcttggga
ctgctagttgtgaacgcctccgaccggtttgagggcgttaagactctgcccaatgagacc
ttcacagactaccccaaacagatcttcagagtgaaaaccacacagttctcctggacggag
atgctcatcatgaagtgggtcttaggaatgatctggtccgaatgcaaggagatctgggag
gaggggccgcgggagtacgtgctacacttgtggaaccttctggattttggcatgctgtcc
atcttcgtggcctccttcactgcgaggttcatggctttcctcaaggccagcgaggcccag
ctgtacgtggaccagtacgtgcaggatgtaacgctgcacaacgtctcacttccaccggaa
gtggcctacttcacctacgccagggataagtggtggccttcagacccccagatcatctcg
gaagggctgtacgccattgcggttgtcctcagcttctcccggatcgcctacatcctgcca
gccaatgagagcttcggacctttgcagatctccctgggaagaactgtgaaagacatcttc
aagttcatggtcatttttatcatggtatttgtggcctttatgatcggaatgttcaacctg
tactcctactaccgaggtgcaaagtacaacccagcgtttaccacagttgaagaaagcttt
aaaaccttgttttggtccatatttggcttgtctgaggtcatctcggtggtgctgaaatac
gaccacaagttcatcgagaatattggctacgtgctgtatggggtttataatgtcaccatg
gtggttgtactactcaacatgctgatagccatgatcaacaactcctatcaggaaatcgag
gaagacgcggacgtggagtggaaatttgctcgagcgaagctctggctttcttactttgat
gaaggaagaactctccctgctccctttaacctggtgccgagccctaaatccttttattat
ctcataatgagaatcaagatgtgcctcatagagctctgccaatctaaggccaaacgctgt
gaaaacgacctggaaatgggcatgctgaactccaagttcaggaagactcgctaccaggct
ggcatgaggaattctgaaaacctgacagccaatagcaccttcagcaagcccaccagatac
cagaagatcatgaagcggctcataaagagatacgtgctgaaggcccaggtggacagagag
aacgatgaagtcaatgaaggtgaactcaaggagatcaaacaagacatctcaagccttcgc
tatgagctcctggaggagaagtctcaggctacaggagagctggcagacctgatccagcag
ctcagcgagaagtttgggaagaatctgaacaaagaccacctgcgggtgaaccagggcaag
gacatttag

DBGET integrated database retrieval system