KEGG   Mus musculus (mouse): 269523Help
Entry
269523            CDS       T01002                                 

Gene name
Vcp, 3110001E05, CDC48, p97, p97/VCP
Definition
valosin containing protein (EC:3.6.4.6)
Orthology
K13525  
transitional endoplasmic reticulum ATPase
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Legionellosis
Module
p97-Ufd1-Npl4 complex
HRD1/SEL1 ERAD complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    269523 (Vcp)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    269523 (Vcp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   269523 (Vcp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4 A5; 4 22.95 cM
AA seq 806 aa AA seqDB search
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggcctctggagccgattcaaaaggtgatgatttatcaacagccattctcaaacagaag
aaccgacccaatcggttaattgttgatgaagccatcaatgaagataacagcgtggtgtcc
ttgtcccagcccaagatggatgaactgcagttgttccgaggtgacacggtgttgctaaaa
ggaaagaaaagacgggaagctgtatgcattgttctttctgatgacacgtgttctgatgag
aagattcgaatgaatagagttgttcggaataacctccgagttcgcctaggagatgtcatc
agcatccagccatgccctgatgtaaagtatggcaaacgtatccacgttctacccatcgat
gacacagtggaaggcatcactggcaatctctttgaggtataccttaagccgtacttcctg
gaagcttatcggcccatccgtaaaggagatatttttcttgtccggggtgggatgcgtgct
gtggagttcaaagttgtagagacagatcccagcccttactgtattgttgctccagacaca
gtgatccactgtgagggggagccaatcaagcgagaggatgaggaggaatccttgaatgaa
gtaggctatgatgacatcggtggttgcaggaagcagctagctcagataaaggagatggtg
gagctgccactgagacatcctgcgctctttaaggcgattggtgtaaagcctcctcgggga
atcttgttgtatgggcctcctgggacagggaagaccctgattgctcgagctgtggcaaat
gaaactggagccttcttctttctgatcaatggtcctgaaatcatgagcaaattggctggt
gagtctgagagcaaccttcgtaaagcctttgaggaagctgaaaagaatgctcctgctatc
atcttcatcgatgagcttgatgccattgcacccaaaagagagaaaactcatggggaagtg
gagcgtcgcatcgtgtctcagttgttgaccctcatggatggcctaaagcagagagcacat
gtgatagttatggcagcaaccaatagacccaacagcattgacccagccctacggcgattt
ggtcgctttgacagagaggtagatattggaatacctgatgctacaggacgtttggagatt
cttcagatccataccaagaacatgaaactggcagatgatgtggacttggaacaggtagcc
aatgagactcatggtcatgttggtgctgatttggcagccctatgttcagaggctgctctg
caggccatccggaaaaaaatggacctcattgacctagaagatgagaccattgatgctgag
gtcatgaattccctggcagttactatggatgacttccggtgggctttgagtcaaagcaac
ccatcagcacttcgggaaactgtggtagaggtgccacaagtaacctgggaagatattgga
ggcctggaggatgtcaaacgtgagcttcaggagttggttcagtatcctgtggaacatcca
gacaaattcctcaaatttggcatgactccctccaaaggcgttcttttctatggacctcct
ggctgtgggaaaaccttactggctaaagccattgctaatgaatgccaggccaacttcatc
tccatcaagggtcctgagctgcttaccatgtggtttggggaatctgaggccaatgtccgg
gaaatttttgacaaggcacggcaagctgccccctgtgtactcttctttgatgagttagat
tcaattgccaaggctcgaggtggtaatattggagatggtggtggagctgctgaccgagtc
atcaatcagatcctgacagaaatggatggcatgtctacaaaaaagaatgtgtttatcatt
ggagctaccaacaggcctgacatcattgatcctgctatcctaagacctggccgtctagat
cagctcatttatatcccacttcctgatgagaagtcccgtgttgccatcctaaaagccaat
ctgcgaaagtccccagttgccaaggatgtggatttggagttcctggctaagatgactaat
ggcttttctggagctgatttgacagaaatttgccaacgggcttgtaaactggccattcgt
gaatctattgagagtgagattaggcgagaacgagagaggcagacaaatccatcggctatg
gaggtagaagaggacgatccagtgcctgagatccgcagagatcactttgaggaagccatg
cgttttgcccgacgttctgtcagcgataatgacattcggaagtatgaaatgttcgcccag
acactgcagcagagtcgaggttttggcagcttcagattcccttcagggaaccagggtgga
gctggtcccagccagggcagtggaggtggcacaggtggcagtgtgtacacagaagacaat
gacgatgacctgtatggctaa

DBGET integrated database retrieval system