KEGG   Mus musculus (mouse): 26987Help
Entry
26987             CDS       T01002                                 

Gene name
Eif4e2, 2700069E09Rik, AI036339, AV129531, D0H0S6743E, Eif4el3
Definition
eukaryotic translation initiation factor 4E member 2
Orthology
K03259  
translation initiation factor 4E
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    26987 (Eif4e2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    26987 (Eif4e2)
   04151 PI3K-Akt signaling pathway
    26987 (Eif4e2)
   04150 mTOR signaling pathway
    26987 (Eif4e2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    26987 (Eif4e2)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    26987 (Eif4e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 D; 1
AA seq 240 aa AA seqDB search
MSLKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYS
RRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWE
DDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNK
TASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaaagatgatgacagtggagaccatgatcagaatgaagaaaacagcacacag
aaagatggtgagaaggaaaaaacagaccgagacaagagccagagcagtggcaagaggaag
gctgttgtccctggaccagcagagcatcccctgcagtacaactacaccttttggtactcg
aggagaacccctggccgtcccaccagctcgcagagctatgagcagaacatcaagcagatt
ggcacctttgcctctgtggagcagttctggaagttttacagccacatggtacgtcctggg
gacctgacaggccacagtgactttcatctcttcaaagaagggattaaacctatgtgggag
gatgatgcaaataaaaatgggggcaagtggatcattcgactccggaagggcttagcttcc
cgctgctgggagaatctcatcctggctatgctcggggagcaattcatggttggggaggag
atctgcggggctgtggtctctgtccgctttcaggaggacattatttctatatggaataag
actgccagcgaccaagcaactacagcccgaatccgggatactcttcggcgcgtgcttaac
ctacctcccaacaccattatggaatacaaaactcacaccgacagcatcaaaatgccaggc
aggctgggcccccaaaggctcctttttcaaaacctctggaagccgcgattgaatgtgcca
tga

DBGET integrated database retrieval system