KEGG   Mus musculus (mouse): 27053Help
Entry
27053             CDS       T01002                                 

Gene name
Asns
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    27053 (Asns)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     27053 (Asns)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C44
   27053 (Asns)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 A1; 6
AA seq 561 aa AA seqDB search
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFDLETVKNNLRILFD
NAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLLPKEILWRPKEAFSDGITSVKNS
WFKILQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYFYRQIFERHYPGRADWLTHYWMPK
WINATDPSARTLTHYKSAAKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatctgggccctcttcggcagcgatgactgcctttccgtgcagtgtctgagt
gcgatgaagatcgcgcacagggggccagatgcatttcgctttgagaatgtcaatggatac
accaactgctgctttggctttcaccgcttggctgtggttgacccgctgtttggaatgcag
ccgataagagtgaggaaatacccttatttgtggctctgttacaatggtgaaatctacaac
cacaaggcgctacagcaacgttttgaatttgaatatcagaccaatgtggatggtgagatt
atcctccacctctatgacaaaggaggcatcgagaaaaccatctgtatgctggacggggtg
tttgcattcatcttactggacactgccaataagaaagtatttctgggcagagacacctat
ggagtcaggcccttgtttaaagccatgacagaagatgggtttctggctgtgtgttcagaa
gctaaaggccttgtttccttaaaacactccaccactcccttcttaaaagtggagcccttc
cttcctggacactatgaagttttggatttaaaaccaaatggcaaagttgcgtctgtggaa
atggtcaaataccatcactgtacggatgaaccattgcatgccatctatgacagcgtggag
aaactcttcccaggctttgacctagagaccgtgaagaacaatctgcgtatcctttttgac
aacgctatcaagaaacgcttgatgacagaccggaggattggctgccttttatcagggggc
ctggactcgagcttggttgctgcctctctgctgaagcaactcaaggaggcccaagttcag
tatcctctccagacatttgctattggcatggaggacagccccgatctcctggccgctaga
aaggtggcaaattatattggaagcgagcatcatgaagtcctttttaactctgaagaaggc
attcaggccctggatgaagtcatattttccttggaaacttatgatattacgacagttcgg
gcatctgtgggcatgtatttaatttccaagtatattcggaagaacacagacagcgtggtg
atcttctccggagaggggtcagatgaacttacacagggctatatatatttccacaaggct
ccttcccctgagaaggccgaggaggagagtgagagactgctgaaggaactctacctgttt
gatgttctccgggccgaccgcactactgctgcacacggtctcgaactgagagtccccttt
ctggatcatcggttttcttcctattacctgtctctgccgccagatatgagaattccaaaa
aatggcatagaaaaacatctcctgagagagacttttgaggactgcaacctgctacccaaa
gagattctctggcgacccaaagaagccttcagtgatgggatcacctcagtcaagaactcc
tggttcaagattttgcaggactatgttgaacatcaggttgatgatgagatgatgtctgca
gcctcccagaagtttcccttcaatactcccaaaactaaggaaggctacttctaccgtcag
atctttgaacgccattacccaggccgggctgattggctgactcattattggatgcctaag
tggatcaatgctactgacccttctgcccgcactctgacccattataagtcagctgccaaa
gcttag

DBGET integrated database retrieval system