KEGG   Mus musculus (mouse): 270672Help
Entry
270672            CDS       T01002                                 

Gene name
Map3k15, BC031147, MEKK15
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 15 (EC:2.7.11.25)
  KO
K13986  
mitogen-activated protein kinase kinase kinase 15 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     270672 (Map3k15)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   270672 (Map3k15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X F4
AA seq 1331 aa AA seqDB search
MEGGGGSGGGGGPVPAEAPEEAGEPPQGRLPPGPEGAAGLAEPESTGDAAGGEAEGGRGP
RRALRAVYVRSESSQGAAAGGGPEAGALKCLLRACEAEGAHLTSVPFGELDFGETAVLDA
FYDADVAIVDMSDISRQPSLFYHLGVRESFDMANNVILYYDTDADTALSLKDMVTQKNTA
SSGNYYFIPYTVTPCADYFCCESDAQRRASEYMQPNWDTILGPLCMPLVDRFTSLLKDIR
VTSCAYYKETLLNDIRKAREKYQGDELAKELTRIKFRMDNIEVLTSDIIINLLLSYRDIQ
DYDAMVKLVETLKMLPTCDLADQHNIKFHYAFALNRRNSTGDREKALQVMLQVLQSCDHP
APDMFCLCGRIYKDIFLDSGCEEDASRDSAIEWYRKGFELQSSLYSGINLAVLLIVSGQQ
FETSMELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFTVSMLASDIGKAVQAAERLFKLK
PPVWYLRSLVQNLLLIQRFKKPITEHSPRQERLNFWLDIIFEATNEVTNGLRFPVLVIEP
TKVYQPSYVSINNEAEERTVSLWHVSPTEMKQIHEWNFTASSIKGISLSKFDERCCFLYV
HDNSDDFQIYFSTEDQCNRFCSLVKEMLNNGVGSTVELEGEADGDTLEYEYDHDANGERV
VLGKGSYGIVYAGRDLSNQVRIAIKEIPERDIRYSQPLHEEIALHKYLKHRNIVQYLGSV
SENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKG
DNVLVNTYSGVVKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWS
LGCTIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKR
VTAADLLQEGFLRQVNKGKKNRIAFKPSEGVRSGTGTLALPSSGELVGSSSSEHGSISPD
SDAQPDAFFEKVQVPKHQLSHLLSVPDESPALDDRSTALPPEERDPGLFLLRKDSERRAI
LYRILWEEQNQVASNLQECVVQSSEELLLSVSHIKQIIGILRDFIRSPEHRVMAATISKL
KVDLDFDSSSINQIHLILFGFQDAVNRILRNHLIRPHWMFAMDNIIRRAVQAAVTILIPE
LQAHFEPASETEGVDKDTEVEGDYPLVDLLSQEVHVTPRGTRPGSVAIQEGQPHQQDPSL
QLSKLRQETNRLWEHLVQKEREYQNLLRLILDQKTQELYHLQLQYKSNGGTENPPPPDGL
GTDRELIDWLQLQGVDANTIEKIVEEDYTLSDILNDITKEDLRCLRLRGGVLCRLWHAVS
QHRRQMQESSQ
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggcggcggcagcggcggcggcggcgggccagtccctgccgaggctccggag
gaagccggcgagccgccccagggcaggctgcccccggggcccgagggcgcggcggggctg
gcggagcccgagagcacgggggacgcggcgggcggcgaggccgagggcgggcgcgggcca
cgccgggctctgcgggctgtctacgtgcgcagcgaaagttcgcagggggcagccgccggc
ggcggccccgaggccggggcgctcaagtgcctgcttcgggcttgcgaagccgagggcgcc
cacctcacctccgtccccttcggggagctcgacttcggggagacggccgtgctcgatgcc
ttctacgatgcagatgttgccattgtggacatgagtgatatctccagacagccttccctt
ttctaccatcttggagtccgagagagttttgacatggctaacaatgtaattctctactat
gatactgatgctgacactgctctgtcattgaaggatatggtcactcaaaaaaacacagca
tccagtggaaattattattttatcccctacactgtgacaccatgtgctgactatttttgc
tgtgagagtgatgcccaaaggagagcctcagagtacatgcagcctaactgggacaccata
ctgggcccgctgtgtatgcccctggtcgacaggttcactagcctccttaaggacatccgt
gtgacttcatgtgcttattataaagaaacattgttaaatgacatccggaaagccagagag
aaataccaaggtgatgaactggcgaaagagttgactcggatcaaattccgtatggataac
attgaggttctgacatcggacatcatcattaacttacttctgtcctaccgtgatatccag
gactacgatgcaatggtcaagctggtagagacactgaagatgctgccaacgtgtgatttg
gctgatcagcacaacattaaatttcactatgcatttgcactgaataggagaaacagcaca
ggtgaccgtgaaaaggctcttcaggttatgctccaagttctgcaaagctgtgaccaccca
gctcctgacatgttttgcctgtgtgggcggatatacaaggacatcttcctggattcaggt
tgtgaagaggatgcaagcagagacagtgccattgagtggtatcgcaaagggtttgaactc
cagtcatccctttattcaggaattaaccttgcagttttgctgatagtttctggacaacag
tttgaaacttcgatggaactaaggaaaataggtgtccggctgaacagtttattgggaaga
aaagggagcctggagaaaatgaacaattactgggatgtaggtcagttcttcaccgtcagc
atgctggcaagtgatattgggaaagctgtccaggcagcagagaggttgttcaaactgaaa
cccccagtctggtacctgcggtcattagttcagaacttgctgttaattcaacgcttcaag
aaacccattacagaacattcacccaggcaggaacggcttaacttctggttagatatcatt
tttgaagcaacgaatgaagttactaatggactcagatttccagttctggtaatagagcca
accaaagtctaccagccttcttatgtttctatcaacaatgaagctgaagaaagaactgtt
tctttatggcatgtctcacccacagaaatgaaacaaatccatgagtggaattttacagcc
tcttctattaaaggaataagcctatccaagtttgatgaacggtgctgttttctttatgtc
catgataattctgatgactttcaaatctacttttccaccgaagaccagtgtaatagattt
tgttctttggtcaaagagatgctaaacaatggagtgggcagtacagtggagttggaggga
gaggctgatggagacaccttagagtatgagtatgaccatgatgcgaatggggagagagtt
gtcttggggaaaggctcctatgggattgtgtatgccggccgtgatctcagtaatcaagta
cggatagccatcaaggaaatcccagagagagatatcaggtactctcagcctctgcatgaa
gaaatagctctgcacaagtatctcaaacatcgcaacatcgtccagtacctaggctctgtt
tcagagaatggctacattaagatatttatggagcaggtgcctggaggaagcctttctgct
ctcttacgatctaaatggggacctatgaaggaacccactatcaagttttataccaaacag
atcctggaaggcctgaagtatctccatgaaaaccagatagtgcacagagacataaaggga
gataatgttctggtgaacacctatagtggagtggtaaaaatctctgattttggaacctct
aaacgcctcgcaggaattaacccatgcaccgagacctttacaggaactctgcagtacatg
gcacctgagattattgatcaaggacctcggggatatggtgctccagctgatatctggtcc
ttgggctgcaccatcattgagatggcaaccagcaggcctccattccatgagcttggtgag
ccccaagcagccatgtttaaggtagggatgtttaagatccaccctgaaattccagaggcc
ctttcagctgaagccagagccttcatcttgtcttgttttgagcctgaccctcagaaacgt
gtcactgctgctgaccttctccaagaagggttcttaaggcaggtgaacaaaggcaaaaag
aaccgaattgctttcaagccttcagagggtgttcggagtggcactggtactctggctctg
ccttcatcaggagagcttgtgggcagcagcagcagcgagcatggctcaatctccccagac
tcggatgcccagcctgatgcattctttgagaaagtccaggtgcccaaacatcagctcagc
caccttctcagtgtcccagatgaaagcccagccttagatgaccgaagcacagccttaccc
ccagaggagagggaccctggtctctttctgctgcgcaaggacagtgagcgcagagccatc
ctttacagaatcctttgggaggaacagaaccaagtggcttccaacttgcaagagtgtgtg
gtccagagttcagaagagttgcttctctcagttagccacatcaaacagataattggaatc
ctgagggacttcatccgctccccagagcacagggtgatggcagccacaatatcaaaacta
aaggtggacctggactttgacagctcatccatcaaccagattcacctgattctgtttggg
ttccaagatgctgtcaatagaattttgagaaaccacttaattaggccccactggatgttt
gcaatggacaacatcattcgcagagctgtgcaggctgcagtcaccattctcattccagag
ctccaagcccactttgagcctgcttctgagactgaaggggtagacaaggacacagaagta
gaaggggactatcccctagtagacctcctcagccaagaagtgcatgtgacacctagaggc
accagacctggctcagtggctatccaggagggccagccccaccagcaagacccaagtctc
caactgagcaagctcaggcaagagaccaacagactttgggaacacctagttcaaaaagag
agggagtaccagaatcttcttcgcctaattctagaccagaaaactcaagaattgtatcac
cttcagttacagtacaaatccaatggtggtacagagaaccctccaccccctgatggactg
ggaaccgacagagagcttatagactggttgcaactacaaggagtggatgccaatacaata
gaaaagattgttgaagaggactatacactttctgatattctcaatgatatcactaaggaa
gacctaaggtgcctccgactacggggtggtgtcctctgtaggctctggcatgcagtctcc
cagcacagaagacaaatgcaggagtcttcacagtga

DBGET integrated database retrieval system