KEGG   Mus musculus (mouse): 271697Help
Entry
271697            CDS       T01002                                 

Gene name
Cdk15, Als2cr7, Pftk2
Definition
(RefSeq) cyclin-dependent kinase 15 (EC:2.7.11.22)
  KO
K15594  
cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     271697 (Cdk15)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   271697 (Cdk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C1.3
AA seq 433 aa AA seqDB search
MGQELCAKRLQPGCSCYHRSEGGEAHSCQRSQPGSTEPAVFELTEASSSTASFHPRGLEA
ASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASSYLNLEKLGEGSYAKVYKGIS
RINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIVHTKETLTFVFEYMH
TDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQRVLHRDLKPQNLLLSHLGELKLAD
FGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLFPG
VSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPPPKPQSLQIVWDRLGGVPEAED
LASQMLKGFPRDRVSAQEALVHDYFSVLPSQLYQLPDEESLFAVSGVKLKPEMCDLSASY
RKRHHLVGVNKCW
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagagctgtgtgcaaagaggctacagccaggatgcagttgctaccaccgttcg
gagggaggggaggcgcacagctgtcagagaagccagcctggaagcaccgagcctgctgta
ttcgagctaacagaagcatccagttccacggcttcatttcaccccaggggactggaggct
gccagtgcccagaagttgaagagtaaaaggccccggagtaacagtgattcttttcaggaa
gagaatctgaggcaggggttgccatggaagaagagcctcccttttggggcagcctcatct
tacttgaacttggagaagctgggtgaaggttcttatgccaaagtttacaagggcatcagc
aggataaatggacaactagtagctctcaaggtcatcagcatgaatgcagaggagggagtc
cctttcacagccatccgggaagcatctctcctgaagggcttgaagcatgccaatattgtc
ctcttgcatgacattgttcacaccaaagagactctgacattcgtatttgaatacatgcat
accgacctggcccagtacatgtctcagcatcctggagggcttcatcctcacaatgtcagg
cttttcatgtttcaacttctgcggggcctggcatacatccaccaccagcgtgttctccac
agggacctgaaacctcagaacttgctcctcagtcacctgggagagctcaaactggctgat
tttggtcttgctcgagccaagtccattcctagccagacatactcctcagaagtggtgaca
ctctggtaccggccacctgacgctttgctgggagccactgagtactcctctgagctagac
atatggggcgcaggctgcatcttcattgaaatgttccagggtcaacctctgtttcctggg
gtatccaacatcctcgaacagctggagaagatctgggaggttctgggagtccctacagag
gatacctggcctggagtctccaaactgcctaactacaatccagaatggttcccgccacct
aaacctcaaagcctgcagattgtctgggacaggctgggtggagttcctgaagctgaagac
ctggcctcccagatgctaaaaggcttccccagggaccgtgtctcagcccaagaagcgctc
gttcatgattatttcagtgtcttgccatcccagttgtaccagcttcctgatgaggagtct
ctgtttgcagtttcgggagtgaagctaaagccagaaatgtgtgacctttcggcttcctac
aggaagagacaccacctagtcggggttaacaaatgttggtga

DBGET integrated database retrieval system