KEGG   Mus musculus (mouse): 27221Help
Entry
27221             CDS       T01002                                 

Gene name
Chaf1a, AL023013, AL024058, CAF-1, Cac1p
Definition
(RefSeq) chromatin assembly factor 1, subunit A (p150)
  KO
K10750  
chromatin assembly factor 1 subunit A
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     27221 (Chaf1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
17; 17 D
AA seq 911 aa AA seqDB search
MLEEPEAATRTAAAVDCKDRPGFPVKRLIQARLPFKRLNLVPKEKVEEDTSPKAAVESKV
PDLQLSLGTFESQCHTGSHVGLSTKLVGGQGPIDSFLRATIKPVPSVVIIDLTENCSDIP
DSPEGHSELSPDTAGVVTTVEGAAKQQEHSAAELCLLETPSDITCHMEEEPGSPGDPKRT
GDCQAGSLQSCPELTPGSRTCPTKELSSWSKAGDLLFIEKVPVVVLEDILATKPSIASLP
MMSLDRSVTSESEILESCPEDDSILSHSSTNSSSPTSSPEGPSTPPEHRGGRSSPSTPAC
RVAKNFVKGSTEKGRSKLHRDREQQREEKEKLREEIRRAKEEARKKKEEEKELKEKERRE
KREKDEKEKAEKQRLKEEKRKERQEALEAKLEEKRKKEEEKRLREEEKRLREEEKRIKAE
KAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRCRAALDQDLCDQLDQLLQQ
QSVASTFLSDLKSRLPLRSGPTRVCGHDTDIMNRDVVIVESSKVDGVSERKKFGRMKLLQ
FSENHRPAYWGTWNKKTAIIRPRNPWAQDKDLLDYEVDSDDEWEEEEPGESLSHSEGDED
DDVGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVHQKLKAKEWDELLAKGKRFRVL
QPVHVGCVWASEAANCTSSDLKLLQQFTACLLDVASPDEPEPGASRREKRDQHILAQLLP
LLHGNVNGSKVIIHEFQEQCRRGLLTLPSPTPHLQMPNLEDAVAVPSKARLKRLISENSA
YEKRPNFRMCWYVHPEVLKSFGQECLPVPCQWTYITTMPSAPREDSGSASTEGPGQSTPM
LLKRKPAATMCITQFMKKRRYDGQVGSGDMDGFQADTEEDEEDDTDCMIIDVPDVGSDVS
EAPIPAPTLCK
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggagccggaggccgcgacgcggacagccgcggccgtggattgcaaagacaga
cccgggttcccagtgaagaggttaatacaagcccgcttgcccttcaaacgcctgaacctt
gttcccaaggagaaagttgaggaagacacatcaccaaaagcagctgtggaaagcaaagtc
ccggatctacaattgtctttgggcacttttgaaagccagtgtcacacaggctctcacgta
ggcttgagtacaaagttggtcggtggccagggccccattgatagcttcttgagggcaaca
atcaagccagtaccgagtgtggtcattatcgacctgacggagaactgcagtgacattcca
gacagccctgagggccacagtgaactaagtcctgacactgctggtgtggtcaccacagtg
gaaggagctgccaagcagcaggagcactctgcagcagagctgtgtctcctagagacccct
tcagacatcacttgtcacatggaagaggagcctgggagtccaggagacccaaagaggacg
ggtgactgtcaggctggttcactacagagctgtccggagctgaccccaggttctaggaca
tgccccaccaaggagttatcaagctggagcaaggcaggggatctcctatttatagagaaa
gtgcctgtggtggtgctagaggacatcctggccactaagccctccattgcctctcttccc
atgatgtccctggataggagtgtcacttcagagagtgaaatactggagtcctgccccgag
gatgactccatactgagccactcctccaccaactcctcttctccaaccagctctcctgag
ggaccatccacacccccagaacatcggggtgggagaagctccccctccaccccagcctgc
agagttgccaagaactttgtcaaaggctccacagagaagggcaggagcaaactgcacaga
gatagagaacagcagagggaagagaaggaaaagctgagggaagagatacgacgagccaag
gaggaggcacggaagaagaaggaggaggagaaggagctgaaggaaaaggagcggagggaa
aagcgggagaaagatgagaaggagaaggcggagaagcagcggctaaaggaggaaaaacgc
aaggagcggcaggaagctctggaggctaaactggaggagaagaggaagaaggaggaagag
aagcggttacgggaggaagagaagcggttacgggaagaagagaagcgcattaaggcagaa
aaggcagagatcactcgattcttccagaaaccgaagactccgcaggctcccaagaccctg
gccggttcctgtggtaagtttgccccctttgaaatcaaagaacacatggtgctggctcca
cggtgccgagctgccttggatcaagacctgtgcgatcagctggaccagctcctgcagcag
cagagtgtggcaagcaccttcctcagtgacctaaaaagccggctgcccttgagatcgggg
cccacccgggtctgtggccatgacacagacatcatgaacagggatgtggtcattgtggag
agcagcaaggtggacggtgtgtctgaaaggaagaagtttggccgcatgaagcttctgcag
ttctcagagaaccaccggccagcatactgggggacgtggaacaagaagacagccatcatc
cgcccccggaacccctgggcccaggacaaagaccttcttgactatgaggtagacagtgac
gatgagtgggaagaggaggaacctggggagtctttgtcccacagtgagggggatgaggat
gacgatgtgggggaagatgaggatgaggacgatggcttctttgtgccccatgggtactta
tctgaagatgaaggcgtgactgaggagtgtgcagaccctgagaaccacaaagtacaccag
aagctgaaggccaaggagtgggatgagctcctagccaagggcaagcgctttcgtgtgctg
cagcctgtgcacgtgggatgtgtatgggcatcagaggcagccaactgcacgagttccgac
ttgaagctgctgcagcagttcactgcatgcctgctggatgtggcatcccctgatgagcca
gaacccggggcctccaggagggaaaagagggaccagcatatcctggcccagttgcttccg
ctgctacatggcaatgtgaatgggagcaaggtgatcatccatgaattccaggagcaatgc
cgcaggggcctgctgacccttccaagtcccaccccacacctgcagatgcccaacttggag
gatgctgttgctgtgccatccaaggccaggctgaagcgccttatctctgagaactctgcc
tatgagaagcggcccaacttccgtatgtgctggtatgtgcacccagaggtgctcaagagc
tttggccaggagtgcctgccagtgccctgccagtggacctacatcaccaccatgccctca
gcacccagggaagacagtggcagtgcttctactgaggggcctggccagagcacacctatg
ctactcaagcggaagccagcggccaccatgtgcatcacgcagtttatgaagaagcggcgc
tatgatggacaggttgggtctggggacatggatggcttccaggcagacacagaagaggat
gaagaggatgacacagactgtatgatcatagatgtgccagatgttgggagtgacgtgtca
gaagctcccatacctgctcccacactttgcaagtga

DBGET integrated database retrieval system