KEGG   Mus musculus (mouse): 277463Help
Entry
277463            CDS       T01002                                 

Gene name
Gpr107, 9930033D15Rik, AI790205, C530034M11, mKIAA1624
Definition
(RefSeq) G protein-coupled receptor 107
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 B
AA seq 551 aa AA seqDB search
MAVPVPLGRFGSFCLRLLRLLALLELLVHPVLGRVHHLALKDDVRHKVHLNTFGFFKDGY
MVVNVSSLSVNEPEGATDKDAEIGFSLDRTKNDGFSSYLDEDVNYCILKKKSMSSVTLVI
LDISGSIVKVRSPPEAGKQLPEIVFSKDEKILSQSQEPAVSSNPKDSEARRTLDGFKAGR
STVDSKAITERSFSIHKNDGVVSFQFFFNISTDDQEGLYSLYFHKCSGNNVKPGEQASFS
LNIAITEKNPNSYLSAGEIPLPKLYVSMALFFFLSGTIWIHILRKRRNDVFKIHWLMAAL
PFTKSLSLVFHAIDYHYISSQGFPIEGWAVVYYITHLLKGALLFITIALIGTGWAFIKHI
LSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYGLWKDSLFLVDLLCCGAILFPVVW
SIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIYFTRIIAFLLKFAVPFQWKWLYQL
LDETATLVFFVLTGYKFRPASDNPYLQLSQEDDDLEMESVVTTSGVMENMKKVKKVSNGA
VEPQGSWEGTA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccggtacccctcggccgcttcggctccttctgcctgcggctgctacgactg
ctggcgttgctggagctgctggtccaccccgtcttgggccgcgtccatcacctggcgctc
aaagatgatgtgcggcataaagtccatctcaacaccttcgggttcttcaaggatgggtac
atggtggtcaacgtcagcagcctctctgtgaacgagcctgagggagccacggacaaggat
gctgagatcggattcagtctggatcggactaagaacgatggcttttcttcttacctggat
gaagatgtgaattactgtattttaaaaaagaagtccatgtcttctgtcactcttgtcatc
ttagacatctctggaagcatagtcaaggtcagatccccaccagaagctggtaagcagtta
ccagagattgtcttcagcaaggatgagaaaatcctgagtcagagccaggagcctgctgtc
agctccaaccccaaagacagtgaggctcggagaaccctcgatggtttcaaggctggacga
agtacagtggactcaaaggctatcacagagcgatccttctcaattcacaagaatgacggg
gtggtctcatttcagttcttctttaacatcagcaccgatgaccaggaaggcctctacagc
ctttacttccacaagtgctcaggcaacaacgtgaagcctggtgaacaggcctcattcagc
ctgaatattgctatcacagagaagaaccctaacagctacctctctgccggggaaatccct
ctccccaagttatatgtttccatggccttgttcttctttctgtctgggaccatttggatt
cacatccttcgtaagagaaggaatgatgtatttaaaattcactggttgatggccgccctt
cctttcaccaagtctctctcgttggtgttccatgcaatcgactaccactacatctcctcg
cagggctttccgattgaaggctgggctgttgtatactacataactcacctgctaaagggc
gcactcctgttcatcaccatcgccctcatcggcactggctgggccttcatcaagcacatc
ctgtctgataaagacaagaagatcttcatgattgtcatcccgctccaggtcctggcgaat
gtggcctacatcatcatagagtccactgaggagggcacaactgagtatggcctatggaag
gactctctgttcctggttgacttgctttgctgtggcgccatcctcttcccagtggtgtgg
tcaatcaggcatttacaagaagcctccgccacagatggaaaagctgccattaacttagcg
aagctgaggcttttcagacattactacgtcttgattgtgtgctacatctactttaccagg
atcatcgccttccttctcaagtttgctgttccattccagtggaagtggctctaccagctg
ctggatgaaacagccacgctggtgttctttgtcctgacggggtataaatttcgcccagct
tcagataacccctacctgcagctctctcaggaagatgatgacctggagatggagtccgta
gtgacgacatcgggtgtgatggagaatatgaagaaggtgaagaaagtgagcaacggtgct
gtggagccccagggcagctgggaaggcaccgcgtga

DBGET integrated database retrieval system