KEGG   Mus musculus (mouse): 278203Help
Entry
278203            CDS       T01002                                 

Gene name
Spaca5, Gm718, Lyze
Definition
(RefSeq) sperm acrosome associated 5
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     278203 (Spaca5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys
Motif
Other DBs
NCBI-GeneID: 278203
NCBI-ProteinID: NP_001078862
MGI: 2685564
Ensembl: ENSMUSG00000037167
Vega: OTTMUSG00000017204
UniProt: A2AE20 A0A077S1H9
Position
X; X A1.3
AA seq 160 aa AA seqDB search
MKVCSIVVVILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVAS
SHKSMKAWDSWTQHCAGHDLSEWLKGCSVRLKTDSSYNNW
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctgcagcattgtggtagtgatcttggccgtattgttgattgccaaattggat
gccaagatttatgaacgctgtgagctggcaaagaagctggaggaggctggcctcgatggc
ttcaaaggctatactgttggagactggctgtgtgtggcacactatgagagtggctttgac
acctcttttgtggaccacaatccagatggcagcagtgaatatggcattttccagctgaac
tctgcctggtggtgtaacaatggcatcacacccactcagaacctctgcaacatcgattgt
aatgacctgctcaaccgccatattctggatgatatcatatgtgccaagagggttgcatcc
tcacataagagtatgaaggcctgggattcctggacccagcactgtgccggtcatgattta
tcagaatggctaaaggggtgttctgtgcgtctgaaaactgactcaagctataataactgg
tga

DBGET integrated database retrieval system