KEGG   Mus musculus (mouse): 27973Help
Entry
27973             CDS       T01002                                 

Gene name
Vkorc1, D7Wsu86e
Definition
(RefSeq) vitamin K epoxide reductase complex, subunit 1 (EC:1.17.4.4)
  KO
K05357  
vitamin-K-epoxide reductase (warfarin-sensitive) [EC:1.17.4.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    27973 (Vkorc1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.4  vitamin-K-epoxide reductase (warfarin-sensitive)
     27973 (Vkorc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F3; 7 69.81 cM
AA seq 161 aa AA seqDB search
MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWG
RGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYL
AWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccacctggaggagccctggactcgtgcggcttgcactgtgcctcgctggctta
gccctctcactgtacgcactgcacgtgaaggcggcgcgcgcccgcgatgaaaattaccgc
gcgctctgcgatgtgggcacggccatcagctgttcccgcgtcttctcctctcggtggggc
cggggctttgggctggtggagcacatgctaggagcggacagcgtcctcaaccaatccaac
agcatatttggttgcctgttctacaccttacagctgttgttaggttgcttgaggggacgt
tgggcctctatcctactggtgctgagttccctggtgtccgtcgctggttccgtgtacctg
gcctggatcctgttctttgtgttatatgatttctgcattgtgtgcattaccacctatgcc
atcaatgtgggtctgatgttgcttagcttccagaaggtaccagaacacaagaccaaaaag
cactga

DBGET integrated database retrieval system