KEGG   Mus musculus (mouse): 27979Help
Entry
27979             CDS       T01002                                 

Gene name
Eif3b, AL033316, AL033334, AL033369, AW208965, D5Wsu45e, EIF3-ETA, EIF3-P110, EIF3-P116, Eif3s9, PRT1
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    27979 (Eif3b)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    27979 (Eif3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
5 G2; 5 78.97 cM
AA seq 803 aa AA seqDB search
MQDAENVAVPEAAEERAEPARQQPASESPPTDEAAGSGGSEVGQTEDAEEDAEAGPEPEV
RAKPAAQSEEETATSPAASPTPQSAERSPSQEPSAPGKAEAVGEQARGHPSAGAEEEGGS
DGSAAEAEPRALENGEADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDN
VPQVGPDRLEKLKNVIHKIFSKFGKIINDYYPEEDGKTKGYIFLEYASPAHAVDAVKNAD
GYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFE
SGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGDKFKQIQRF
SHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKW
SHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPA
RVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMRE
KQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKSNGKIELIKMFDKQQA
NTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVS
WWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQDQIKQIKKDLKKYSKIF
EQKDRLSQSKASKELVERRRTMMEDFRQYRKMAQELYMKQKNERLELRGGVDTDELDSNV
DDWEEETIEFFVTEEVIPLGSQE
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgctgagaacgtggcggtgcccgaggcggccgaggagcgggctgagcccgcg
aggcagcagccggcctccgagtcgccgccgacggacgaggcggcagggtctggggggtcc
gaagtggggcagacggaagacgccgaagaagacgccgaggccggaccggagcccgaagtg
agggccaagccggcggcccaatccgaagaggaaacggcgacgagtccggccgcctcgccc
acgccgcagtcggcggagcggtccccgtcgcaggagccctctgctcccgggaaggcagag
gccgttggcgagcaggcccgggggcacccctcggctggagcggaggaggagggcgggtct
gatgggagcgcggctgaggcggagccgcgggctctggagaacggagaggcagatgagccc
tccttcagcgaccccgaggatttcgtagacgacgtgagcgaggaagaactacttggtgat
gtactcaaagatcggcctcaggaagcggacgggattgactcggtgattgttgtagacaac
gtccctcaggtggggccagaccgacttgagaaactcaaaaatgtcatccacaagatcttc
tccaagtttgggaaaatcataaatgactattaccctgaggaggacggaaagacgaaaggg
tacatctttctggagtacgcttctcccgcccatgctgtggatgctgtgaaaaacgccgat
ggctacaagctggacaagcagcacacgttccgggtcaacctcttcaccgactttgacaag
tacatgacgatcagcgatgagtgggacattccagagaagcagcctttcaaagacctgggc
aatttgcgttactggctggaagaggcagagtgtagagatcagtacagtgtgatttttgag
agcggagaccggacgtccatcttctggaatgacgtcaaggacccagtctcaattgaagaa
agagcgagatggacagagacgtacgtgcgctggtcccctaagggtacctacctggccact
ttccatcagcggggtatcgccctctggggaggggacaagttcaagcagattcagaggttc
agccaccaaggcgtgcagctcatcgacttctctccgtgtgaaagatacttggtaacgttc
agccctctgatggacactcaggatgaccctcaggccatcatcatctgggacatcctcacg
ggccataagaagagaggttttcactgcgaaagctcagcccactggcccatcttcaagtgg
agccatgatggcaaattctttgcaagaatgaccctggatactcttagcatctatgaaaca
ccttccatgggccttttggacaagaagagtttgaagatctctggaattaaagacttttct
tggtctccgggtggtaacatcattgctttttgggtgcctgaagacaaagatattccagcc
agggtgaccctgatgcagctccccaccagacaggagatccgagtgaggaatttgttcaat
gtggttgattgcaagctgcactggcagaaaaatggagattacctatgtgtaaaagtggac
aggactccgaaaggcacacagggagttgtcacaaattttgaaatattccgaatgagggag
aagcaggtacctgttgatgttgttgagatgaaagaaaccatcatagcctttgcctgggaa
cccaatggcagtaagtttgccgtgcttcatggtgaggcccctcggatctctgtctccttc
taccacgtgaagagcaacgggaagattgaactcatcaagatgtttgacaagcagcaagcc
aacaccatcttctggagtccccaggggcagttcgtggtgctggccgggctgaggagcatg
aacggtgccttggcgtttgtcgacacttcagactgcaccgtcatgaacattgcagagcac
tacatggcctccgatgttgaatgggacccaactggccgctacgtggttacctctgtgtcg
tggtggagccacaaggtggacaatgcttactggctgtggaccttccaaggtcgccttctg
cagaagaacaacaaggaccgcttctgccagctgctctggagaccaaggcccccaacactc
ctcagccaggatcagataaagcaaattaaaaaggatctgaagaagtactccaagatcttt
gagcagaaggatcgcttgagccagtccaaagcttcaaaggaactggtggaaagaaggcgg
accatgatggaggacttccggcaataccggaaaatggcccaggaactctacatgaagcag
aagaacgagcgtctagagctacgaggaggggtggacactgacgagctggacagcaacgtg
gatgactgggaggaagagaccattgagttttttgtcaccgaggaagtcattcctctggga
agtcaggagtga

DBGET integrated database retrieval system