KEGG   Mus musculus (mouse): 286940Help
Entry
286940            CDS       T01002                                 

Gene name
Flnb, AL024016, Fln-b
Definition
filamin, beta
Orthology
K04437  
filamin
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    286940 (Flnb)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    286940 (Flnb)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    286940 (Flnb)
  Infectious diseases
   05132 Salmonella infection
    286940 (Flnb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   286940 (Flnb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
Position
14 A1; 14
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQGKNSVELLVEDRGNQVYRCVYKP
VQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGC
TINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIP
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYRGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKL
GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVRESIT
RTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPV
IAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTG
IQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPN
HISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgacggagaaagacctggcggaggacgcgccgtggaagaagattcagcagaac
acgttcacgcgctggtgcaacgagcacctcaagtgtgtgaataaacgcatcgggaacctg
cagaccgacctgagcgacgggctacggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgcaccacaagtaccatcagcggcccaccttcagacagatgaagctggagaatgtg
tctgtggctctggagttcctagaccacgaaagcattaagctcgtgtccattgacagtaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtatggactttgatccttcac
tactccatctccatgcccgtatgggaagatgaaggggatgatgatgccaagaagcagaca
ccaaagcagaggctactgggatggattcagaacaagattccatacttgcccatcactaac
tttaaccagaactggcaagatggcaaagccttaggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccacggaagccggtggataatgcccgagaa
gccatgcagcaggccgatgactggctgggcgtcccacaggtcatcactcctgaggagatt
attcacccggacgtggacgagcactctgtgatgacctacctgtctcagttccccaaagcc
aagctcaagccaggtgctcctcttaaacccaaactcaacccaaagaaagcccgagcctat
ggcagaggaatcgaacctactggaaacatggtgaagcagccagccaaattcacggtagat
accatcagcgctggacaaggagatgtgatggtgtttgttgaggacccagaaggaaacaag
gaagaggcacgtgtgaccccagacagtgacaagaacaagacatactctgtggagtatctg
cccaaagtcaccggcctgcataaagtcatcgtcctctttgcaggacagcacatttctaag
agcccatttgaagtgaatgttgacaaagcccaaggagatgccagcaaagtcactgcaaaa
ggcccagggctggaaactacagggaacattgccaacaagcctacctattttgacatctac
acagctggagctggcgtgggggacatcggcattgaggtggaggatccccagggcaagaac
agcgtggagctgctggtggaagacagaggaaaccaggtgtatagatgtgtctacaaacca
gtgcagcctggcccccatgtggtcaaggtctcctttgctggggatgccattcccaagagt
ccctttggtgtacaaattggggaagcctgcaacccaaatgcctgcagagccagcggccga
ggtctgcagcccaaaggtgtccggatccgggagactgcagactttaaggtggacaccaag
gctgctggaagcggagagcttggtgtaactgtgaagggccctaagggcctggaggagctg
gtcaaacaaaagggctttctggatggggtctactcatttgagtactaccccagcacacca
gggaaatacagcgttgcagttacctggggggggcaccacattcccaagagcccctttgaa
gttcaagttggccctgaagcaggcatgcagaaagtccgtgcatggggccctggactccac
ggcggcattgttggtcggtcagcagattttgtggtggaatccattggttctgaggttgga
actctgggatttgccattgaaggcccttcccaagcaaagatcgagtatgatgatcagaac
gatggctcgtgtgatgtcaaatactggcccaaggagcctggagaatacgccgttcacatc
atgtgcgacgacgaagacatcaaggacagcccatacatggctttcatccaccctgccaca
ggagactacaacccagatctagtccaagcctatgggccgggtttggagaaatctggttgt
actatcaacaacccagcagagttcattgtggatcctaaggatgccgggagtgctccctta
aagatactggcgcaggatggggaaggccagcccattgacatccagatgaagagtcggatg
gacggcacttatgcttgctcatataccccacttaaagccatcaagcacaccatcgctgtg
gtctggggaggtgtgaacataccacacagcccctacagggtcaacattgggcaaggtagc
catccccaaaaggtcaaagtgtttggcccaggcgtggagaggagtggtctgaaggcaaat
gagcctactcactttacagtggattgcacggaggccggggaaggtgatgtcagtgttggt
atcaagtgcgatgcccgagttttaagtgacgatgaggaagatgtcgattttgacattatt
cacaatgccaatgacacattcactgtcaaatacgtacctcctgcccctgggcggtatacc
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccatgacgccagcaaggtgaaggcagaaggccccgggttgagtaaagcaggcgtg
gaaaatgggaagccaacccacttcactgttcacaccaagggagccggaaaagctccgctc
aacgtgcagttcagcagcccccttcctggggaggcagtgaaggacttggatatcattgat
aattatgactactcacatactgttaaatacaccccaacccagcagggcaacatgcaggtt
ctagtgacttatggtggcgatcccattcctaaaagtcctttcactgtgggcgttgctgcg
ccactggatctgagcaagataaaaattaatggactggaaaacagagttgaggttggaaag
gaccaggaatttgccattgacaccaacggggcaggaggccaggggaagctggatgtgacc
atcctgagcccttctcggaaggtggtgccatgcttggtagcaccagtggctggcagggaa
tgcagcacagccaaattcatccctcgggaggaggggctgtttgctgtagatgtgacctat
gatggacacccagtgcccgggagcccctatactgtggaggcctcactaccaccagatccc
accaaggtgaaggcccacggtcctggccttgaaggaggtcttgtaggcaagcccgctgag
ttcaccattgacactaaaggagctggaactggaggtttgggcctaactgtggaaggtcca
tgtgaggccaaaatcgaatgctcggataacggtgacgggacctgctccgtctcctacctt
cccacaaaacccggagaatactttgtcaacattctctttgaagaagtccacattcctgga
tctcccttcaaagccgacattgaaatgccgtttgacccctctaaggttgtagcgtcagga
ccaggacttgaacacggaaaagtgggtgaacccggaatcctttgcgttgattgttcagaa
gcagggcctgggactctgggccttgaagccgtctcagactcaggggcgaaagctgaagtg
tccatccagaacaataaagatggcacctacgctgtgacctatgtgcctctgacagctggc
atgtacacactgaccatgaagtatggtggtgagcttgtaccacactttcctgcctgggtc
aaggtggagccagccatagacactagtgggatcaaagcctttgggccaggaatcgaaggc
aaggacgtgtttcgggaggccacaacggacttcacggttgactcgaggccccttacccag
gttggaggtgaccatatcaaagctcaaattaccaacccctcgggggcctccaccgagtgc
tttgtcaaggacaatgctgatgggacctatcaggtcgaatacacgccctttgagaaaggt
ttccatgtagtggaggtgacatacgatgatgtgcccatcccaaatagcccattcaaagtg
gctgtcactgaaggctgccagccatctcgggtccatgcgcaaggccctggactgaaagag
gcgtttaccaacaaatctaatgtcttcacagtggtaaccaggggagcagggatcggtggg
cttggcataactgtggaggggccgtcggagtcaaagataaactgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccaggggattatgacgtcaatatcacg
tacggaggcgtccacatccctggcagccccttcagagttccttcaaaagatgttgtggat
cccagcaaggtcaagattgctggccccggtctgagctcctgtgtccgagcatgcatcccg
cagtccttcacagtggacagcagcaaggctggcctagctcccctggaagtgagggtcctg
ggcccaagaggcctcgtggagccggtgaatgtggtagataatggggacggcacccacaca
gtgacctacacgccatctcaggaggggccctacattgtttccgtcaaatatgctgatgaa
gagatcccccgaagtccctttaaggtcaaggttcttcccacatacgatgcaagcaaagtg
acagcctctgggcctggcctcagcgcctatggggtacccgccagcctacctgtggagttc
gccattgatgccagagatgctggcgaaggcctgcttgctgtccagatcacggaccaggag
ggaaagcctcaaagagctactgtccacgacaacaaagatggcacatatgccgttacctat
atccctgataagaccggacgctatatgattggagtcacctatggtggagacaacattcca
ctttctccttaccgtatccgggccacacagacaggcgatgccagcaagtgcttggccaca
ggtcctggtattgcccccactgtgaaaactggcgaggaggtgggctttgtagtggacgct
aagactgcagggaaggggaaagtaacctgcgtgattctgaccccagatggcaccgaggct
gaggctgacgtcattgaaaatgaagatggcacctatgacattttctacactgctgccaag
ccaggcacctatgttatctatgtgcgctttggtggcgttgatattcccaatagccccttc
acagtcatggccaccgatggggaagtcacagccatggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggttacagaagaggcctatgtccctgtgagtgacatgaac
gggctaggcttcaagccctttgacttggtgattccatttgccgtcaggaaaggagaaatt
acaggcacggtgcatatgccttctgggaagaaggctacacctgagattgtggacaacaag
gacggcacggtcactgtgagatacgcgcccactgaagtcggcctccacgagatgcacatc
aagtacaggggcagccacatcccggagagccccctgcagttctacgtgaactaccccaac
agtgggagtgtgtctgcttatggtccaggccttgtgtatggagtagccaacaaaactgcc
accttcaccattgtcacagaggatgcgggagaaggtggtctggacttggctattgaagga
ccctcgaaagcagagatcagctgcattgacaacaaagacgggacatgtacagtgacctac
ctacccaccttgccaggggactacagcattctggtcaagtacaatgacaaacatattcct
ggcagccccttcactgccaagatcacagatgataacagacgctgctcccaagtgaagctg
ggctcagctgctgacttccttctggacatcagtgagacagaccttagcacactgacagcc
agtatcaaggccccatctggacgtgacgagccctgtctgctaaagaggctacccaacaac
cacattggcatttccttcatcccccgagaagtgggtgagcatctagtcagcatcaagaaa
aacggtaaccacgtggccaacagccctgtgtccattatggtggtccagtctgaaattggt
gatgcacgccgagccaaagtctatggccaaggcctgtcagaaggccggacttttgagatg
tcagacttcatcgtggacacaagagatgcaggctatggtggcatatccttggcagtagaa
ggacccagcaaggtggacatccaaacagaggacctggaggacggcacctgcaaggtgtcc
tacttccccactgtgcccggggtctatatcgtctccaccaaatttgctgacgagcatgtg
cctggaagcccattcactgtgaagatcagtggcgagggaagagtcagagagagcatcacc
cggaccagccgggctccggctgtggccacggttggcagtatctgtgacctgaacctgaag
atcccggagatcaacagcagtgacatgtctgcccatgtcaccagcccctctggccatgtc
actgaggcagagattgtgcccatgggaaagaactctcactgtgtcagatttgtgccccag
gagatgggcgttcacactgtcagcgtaaagtaccgcggacagcacgtaacaggaagcccg
ttccagttcaccgtggggccccttggcgaagggggtgcccacaaggtccgggcaggaggc
cctggcctggagaggggagaagcaggcatcccagctgagttcagcatctggacccgggaa
gcaggtgctggcggcctctccattgctgttgagggccctagtaaggccgagatcacattc
gatgaccataaaaatgggtcatgcggtgtgtcttatattgcccaagagcctggtaactac
gaggtgtctatcaagttcaacgacgagcacatcccggacagcccttacctggtgcccgtc
atcgcgccctcagacgacgctcgctgcctcactgttctgagccttcaggaatcaggatta
aaagttaaccagccagcgtcctttgctataaggttgaatggtgcgaaagggaagattgat
gcaaaggtgcacagcccctcaggagccgtggaggaatgccacgtgtctgaactggagcca
gataagtatgccgttcgcttcatcccgcatgagaatggcatccacacgatcgatgtcaag
tttaacgggagccacgtggtcgggagccctttcaaagtacgtgtaggagagcctggccag
gcaggcaatcctgctctagtgtcagcctacggtgctgggcttgagacgggcaccacaggt
atccaatcagaattcttcatcaataccactcaggcaggcccagggacattatctgtcacc
attgaaggaccatccaaggtcaaaatggattgccaggaaatcccagaggggtacaaagtc
atgtacactcccatggctcctggaaattacctgattggtgtcaaatatggcgggcccaac
cacatctcgaggagtccattcaaggccaaggtgacaggccaacgtctggtcagcccaggc
tcagccaacgagacctcctccatcttggtggagtccgtaaccagatcctcaacggaaacg
tgctatagcgccattcccaagtcgtcctccgatgccagcaaagtgacctccaagggcgca
ggcctgtcaaaggcttttgtgggccagaagagttctttcctggtggactgcagcaaagct
gggtccaacatgctgttgattggggtccatgggcccaccaccccctgtgaagaggtctcc
atgaagcatgtgggcaagcaacagtacaacgtcacctacgtcgtcaaggagaggggcgat
tacgttctggctgtgaagtggggggaagagcacatccccggtagcccctttcatgtcacc
gtgccttaa

DBGET integrated database retrieval system