KEGG   Mus musculus (mouse): 286940Help
Entry
286940            CDS       T01002                                 

Gene name
Flnb, AL024016, Fln-b
Definition
(RefSeq) filamin, beta
  KO
K04437  
filamin
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    286940 (Flnb)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    286940 (Flnb)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    286940 (Flnb)
  Infectious diseases
   05132 Salmonella infection
    286940 (Flnb)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     286940 (Flnb)
  Intermediate filaments
   Intermediate filament-binding proteins
    286940 (Flnb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   286940 (Flnb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14; 14 A1
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQGKNSVELLVEDRGNQVYRCVYKP
VQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGC
TINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIP
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYRGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKL
GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVRESIT
RTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPV
IAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTG
IQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPN
HISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgacggagaaagacctggcggaggacgcgccgtggaagaagattcagcagaac
acgttcacgcgctggtgcaacgagcacctcaagtgtgtgaataaacgcatcgggaacctg
cagaccgacctgagcgacgggctacggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgcaccacaagtaccatcagcggcccaccttcagacagatgaagctggagaatgtg
tctgtggctctggagttcctagaccacgaaagcattaagctcgtgtccattgacagtaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtatggactttgatccttcac
tactccatctccatgcccgtatgggaagatgaaggggatgatgatgccaagaagcagaca
ccaaagcagaggctactgggatggattcagaacaagattccatacttgcccatcactaac
tttaaccagaactggcaagatggcaaagccttaggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccacggaagccggtggataatgcccgagaa
gccatgcagcaggccgatgactggctgggcgtcccacaggtcatcactcctgaggagatt
attcacccggacgtggacgagcactctgtgatgacctacctgtctcagttccccaaagcc
aagctcaagccaggtgctcctcttaaacccaaactcaacccaaagaaagcccgagcctat
ggcagaggaatcgaacctactggaaacatggtgaagcagccagccaaattcacggtagat
accatcagcgctggacaaggagatgtgatggtgtttgttgaggacccagaaggaaacaag
gaagaggcacgtgtgaccccagacagtgacaagaacaagacatactctgtggagtatctg
cccaaagtcaccggcctgcataaagtcatcgtcctctttgcaggacagcacatttctaag
agcccatttgaagtgaatgttgacaaagcccaaggagatgccagcaaagtcactgcaaaa
ggcccagggctggaaactacagggaacattgccaacaagcctacctattttgacatctac
acagctggagctggcgtgggggacatcggcattgaggtggaggatccccagggcaagaac
agcgtggagctgctggtggaagacagaggaaaccaggtgtatagatgtgtctacaaacca
gtgcagcctggcccccatgtggtcaaggtctcctttgctggggatgccattcccaagagt
ccctttggtgtacaaattggggaagcctgcaacccaaatgcctgcagagccagcggccga
ggtctgcagcccaaaggtgtccggatccgggagactgcagactttaaggtggacaccaag
gctgctggaagcggagagcttggtgtaactgtgaagggccctaagggcctggaggagctg
gtcaaacaaaagggctttctggatggggtctactcatttgagtactaccccagcacacca
gggaaatacagcgttgcagttacctggggggggcaccacattcccaagagcccctttgaa
gttcaagttggccctgaagcaggcatgcagaaagtccgtgcatggggccctggactccac
ggcggcattgttggtcggtcagcagattttgtggtggaatccattggttctgaggttgga
actctgggatttgccattgaaggcccttcccaagcaaagatcgagtatgatgatcagaac
gatggctcgtgtgatgtcaaatactggcccaaggagcctggagaatacgccgttcacatc
atgtgcgacgacgaagacatcaaggacagcccatacatggctttcatccaccctgccaca
ggagactacaacccagatctagtccaagcctatgggccgggtttggagaaatctggttgt
actatcaacaacccagcagagttcattgtggatcctaaggatgccgggagtgctccctta
aagatactggcgcaggatggggaaggccagcccattgacatccagatgaagagtcggatg
gacggcacttatgcttgctcatataccccacttaaagccatcaagcacaccatcgctgtg
gtctggggaggtgtgaacataccacacagcccctacagggtcaacattgggcaaggtagc
catccccaaaaggtcaaagtgtttggcccaggcgtggagaggagtggtctgaaggcaaat
gagcctactcactttacagtggattgcacggaggccggggaaggtgatgtcagtgttggt
atcaagtgcgatgcccgagttttaagtgacgatgaggaagatgtcgattttgacattatt
cacaatgccaatgacacattcactgtcaaatacgtacctcctgcccctgggcggtatacc
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccatgacgccagcaaggtgaaggcagaaggccccgggttgagtaaagcaggcgtg
gaaaatgggaagccaacccacttcactgttcacaccaagggagccggaaaagctccgctc
aacgtgcagttcagcagcccccttcctggggaggcagtgaaggacttggatatcattgat
aattatgactactcacatactgttaaatacaccccaacccagcagggcaacatgcaggtt
ctagtgacttatggtggcgatcccattcctaaaagtcctttcactgtgggcgttgctgcg
ccactggatctgagcaagataaaaattaatggactggaaaacagagttgaggttggaaag
gaccaggaatttgccattgacaccaacggggcaggaggccaggggaagctggatgtgacc
atcctgagcccttctcggaaggtggtgccatgcttggtagcaccagtggctggcagggaa
tgcagcacagccaaattcatccctcgggaggaggggctgtttgctgtagatgtgacctat
gatggacacccagtgcccgggagcccctatactgtggaggcctcactaccaccagatccc
accaaggtgaaggcccacggtcctggccttgaaggaggtcttgtaggcaagcccgctgag
ttcaccattgacactaaaggagctggaactggaggtttgggcctaactgtggaaggtcca
tgtgaggccaaaatcgaatgctcggataacggtgacgggacctgctccgtctcctacctt
cccacaaaacccggagaatactttgtcaacattctctttgaagaagtccacattcctgga
tctcccttcaaagccgacattgaaatgccgtttgacccctctaaggttgtagcgtcagga
ccaggacttgaacacggaaaagtgggtgaacccggaatcctttgcgttgattgttcagaa
gcagggcctgggactctgggccttgaagccgtctcagactcaggggcgaaagctgaagtg
tccatccagaacaataaagatggcacctacgctgtgacctatgtgcctctgacagctggc
atgtacacactgaccatgaagtatggtggtgagcttgtaccacactttcctgcctgggtc
aaggtggagccagccatagacactagtgggatcaaagcctttgggccaggaatcgaaggc
aaggacgtgtttcgggaggccacaacggacttcacggttgactcgaggccccttacccag
gttggaggtgaccatatcaaagctcaaattaccaacccctcgggggcctccaccgagtgc
tttgtcaaggacaatgctgatgggacctatcaggtcgaatacacgccctttgagaaaggt
ttccatgtagtggaggtgacatacgatgatgtgcccatcccaaatagcccattcaaagtg
gctgtcactgaaggctgccagccatctcgggtccatgcgcaaggccctggactgaaagag
gcgtttaccaacaaatctaatgtcttcacagtggtaaccaggggagcagggatcggtggg
cttggcataactgtggaggggccgtcggagtcaaagataaactgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccaggggattatgacgtcaatatcacg
tacggaggcgtccacatccctggcagccccttcagagttccttcaaaagatgttgtggat
cccagcaaggtcaagattgctggccccggtctgagctcctgtgtccgagcatgcatcccg
cagtccttcacagtggacagcagcaaggctggcctagctcccctggaagtgagggtcctg
ggcccaagaggcctcgtggagccggtgaatgtggtagataatggggacggcacccacaca
gtgacctacacgccatctcaggaggggccctacattgtttccgtcaaatatgctgatgaa
gagatcccccgaagtccctttaaggtcaaggttcttcccacatacgatgcaagcaaagtg
acagcctctgggcctggcctcagcgcctatggggtacccgccagcctacctgtggagttc
gccattgatgccagagatgctggcgaaggcctgcttgctgtccagatcacggaccaggag
ggaaagcctcaaagagctactgtccacgacaacaaagatggcacatatgccgttacctat
atccctgataagaccggacgctatatgattggagtcacctatggtggagacaacattcca
ctttctccttaccgtatccgggccacacagacaggcgatgccagcaagtgcttggccaca
ggtcctggtattgcccccactgtgaaaactggcgaggaggtgggctttgtagtggacgct
aagactgcagggaaggggaaagtaacctgcgtgattctgaccccagatggcaccgaggct
gaggctgacgtcattgaaaatgaagatggcacctatgacattttctacactgctgccaag
ccaggcacctatgttatctatgtgcgctttggtggcgttgatattcccaatagccccttc
acagtcatggccaccgatggggaagtcacagccatggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggttacagaagaggcctatgtccctgtgagtgacatgaac
gggctaggcttcaagccctttgacttggtgattccatttgccgtcaggaaaggagaaatt
acaggcacggtgcatatgccttctgggaagaaggctacacctgagattgtggacaacaag
gacggcacggtcactgtgagatacgcgcccactgaagtcggcctccacgagatgcacatc
aagtacaggggcagccacatcccggagagccccctgcagttctacgtgaactaccccaac
agtgggagtgtgtctgcttatggtccaggccttgtgtatggagtagccaacaaaactgcc
accttcaccattgtcacagaggatgcgggagaaggtggtctggacttggctattgaagga
ccctcgaaagcagagatcagctgcattgacaacaaagacgggacatgtacagtgacctac
ctacccaccttgccaggggactacagcattctggtcaagtacaatgacaaacatattcct
ggcagccccttcactgccaagatcacagatgataacagacgctgctcccaagtgaagctg
ggctcagctgctgacttccttctggacatcagtgagacagaccttagcacactgacagcc
agtatcaaggccccatctggacgtgacgagccctgtctgctaaagaggctacccaacaac
cacattggcatttccttcatcccccgagaagtgggtgagcatctagtcagcatcaagaaa
aacggtaaccacgtggccaacagccctgtgtccattatggtggtccagtctgaaattggt
gatgcacgccgagccaaagtctatggccaaggcctgtcagaaggccggacttttgagatg
tcagacttcatcgtggacacaagagatgcaggctatggtggcatatccttggcagtagaa
ggacccagcaaggtggacatccaaacagaggacctggaggacggcacctgcaaggtgtcc
tacttccccactgtgcccggggtctatatcgtctccaccaaatttgctgacgagcatgtg
cctggaagcccattcactgtgaagatcagtggcgagggaagagtcagagagagcatcacc
cggaccagccgggctccggctgtggccacggttggcagtatctgtgacctgaacctgaag
atcccggagatcaacagcagtgacatgtctgcccatgtcaccagcccctctggccatgtc
actgaggcagagattgtgcccatgggaaagaactctcactgtgtcagatttgtgccccag
gagatgggcgttcacactgtcagcgtaaagtaccgcggacagcacgtaacaggaagcccg
ttccagttcaccgtggggccccttggcgaagggggtgcccacaaggtccgggcaggaggc
cctggcctggagaggggagaagcaggcatcccagctgagttcagcatctggacccgggaa
gcaggtgctggcggcctctccattgctgttgagggccctagtaaggccgagatcacattc
gatgaccataaaaatgggtcatgcggtgtgtcttatattgcccaagagcctggtaactac
gaggtgtctatcaagttcaacgacgagcacatcccggacagcccttacctggtgcccgtc
atcgcgccctcagacgacgctcgctgcctcactgttctgagccttcaggaatcaggatta
aaagttaaccagccagcgtcctttgctataaggttgaatggtgcgaaagggaagattgat
gcaaaggtgcacagcccctcaggagccgtggaggaatgccacgtgtctgaactggagcca
gataagtatgccgttcgcttcatcccgcatgagaatggcatccacacgatcgatgtcaag
tttaacgggagccacgtggtcgggagccctttcaaagtacgtgtaggagagcctggccag
gcaggcaatcctgctctagtgtcagcctacggtgctgggcttgagacgggcaccacaggt
atccaatcagaattcttcatcaataccactcaggcaggcccagggacattatctgtcacc
attgaaggaccatccaaggtcaaaatggattgccaggaaatcccagaggggtacaaagtc
atgtacactcccatggctcctggaaattacctgattggtgtcaaatatggcgggcccaac
cacatctcgaggagtccattcaaggccaaggtgacaggccaacgtctggtcagcccaggc
tcagccaacgagacctcctccatcttggtggagtccgtaaccagatcctcaacggaaacg
tgctatagcgccattcccaagtcgtcctccgatgccagcaaagtgacctccaagggcgca
ggcctgtcaaaggcttttgtgggccagaagagttctttcctggtggactgcagcaaagct
gggtccaacatgctgttgattggggtccatgggcccaccaccccctgtgaagaggtctcc
atgaagcatgtgggcaagcaacagtacaacgtcacctacgtcgtcaaggagaggggcgat
tacgttctggctgtgaagtggggggaagagcacatccccggtagcccctttcatgtcacc
gtgccttaa

DBGET integrated database retrieval system