KEGG   Mus musculus (mouse): 286940Help
Entry
286940            CDS       T01002                                 

Gene name
Flnb, AL024016
Definition
filamin, beta
Orthology
K04437  
filamin
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:mmu05205]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mmu05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14 A1; 14
AA seq 2591 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQGKNSVELLVEDRGNQVYRCVYKP
VQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGC
TINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIP
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVTEEAYVPVSDMNGLGFKPFDLVI
PFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESP
LQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDN
KDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKLGSAADFLLDIS
ETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVS
IMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTED
LEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVRESITRTSRAPAVATV
GSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKY
RGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVE
GPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARCLT
VLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHE
NGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQ
AGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPNHISRSPFKAKV
TGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGAGLSKAFVGQKS
SFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEH
IPGSPFHVTVP
NT seq 7776 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgacggagaaagacctggcggaggacgcgccgtggaagaagattcagcagaac
acgttcacgcgctggtgcaacgagcacctcaagtgtgtgaataaacgcatcgggaacctg
cagaccgacctgagcgacgggctacggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgcaccacaagtaccatcagcggcccaccttcagacagatgaagctggagaatgtg
tctgtggctctggagttcctagaccacgaaagcattaagctcgtgtccattgacagtaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtatggactttgatccttcac
tactccatctccatgcccgtatgggaagatgaaggggatgatgatgccaagaagcagaca
ccaaagcagaggctactgggatggattcagaacaagattccatacttgcccatcactaac
tttaaccagaactggcaagatggcaaagccttaggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccacggaagccggtggataatgcccgagaa
gccatgcagcaggccgatgactggctgggcgtcccacaggtcatcactcctgaggagatt
attcacccggacgtggacgagcactctgtgatgacctacctgtctcagttccccaaagcc
aagctcaagccaggtgctcctcttaaacccaaactcaacccaaagaaagcccgagcctat
ggcagaggaatcgaacctactggaaacatggtgaagcagccagccaaattcacggtagat
accatcagcgctggacaaggagatgtgatggtgtttgttgaggacccagaaggaaacaag
gaagaggcacgtgtgaccccagacagtgacaagaacaagacatactctgtggagtatctg
cccaaagtcaccggcctgcataaagtcatcgtcctctttgcaggacagcacatttctaag
agcccatttgaagtgaatgttgacaaagcccaaggagatgccagcaaagtcactgcaaaa
ggcccagggctggaaactacagggaacattgccaacaagcctacctattttgacatctac
acagctggagctggcgtgggggacatcggcattgaggtggaggatccccagggcaagaac
agcgtggagctgctggtggaagacagaggaaaccaggtgtatagatgtgtctacaaacca
gtgcagcctggcccccatgtggtcaaggtctcctttgctggggatgccattcccaagagt
ccctttggtgtacaaattggggaagcctgcaacccaaatgcctgcagagccagcggccga
ggtctgcagcccaaaggtgtccggatccgggagactgcagactttaaggtggacaccaag
gctgctggaagcggagagcttggtgtaactgtgaagggccctaagggcctggaggagctg
gtcaaacaaaagggctttctggatggggtctactcatttgagtactaccccagcacacca
gggaaatacagcgttgcagttacctggggggggcaccacattcccaagagcccctttgaa
gttcaagttggccctgaagcaggcatgcagaaagtccgtgcatggggccctggactccac
ggcggcattgttggtcggtcagcagattttgtggtggaatccattggttctgaggttgga
actctgggatttgccattgaaggcccttcccaagcaaagatcgagtatgatgatcagaac
gatggctcgtgtgatgtcaaatactggcccaaggagcctggagaatacgccgttcacatc
atgtgcgacgacgaagacatcaaggacagcccatacatggctttcatccaccctgccaca
ggagactacaacccagatctagtccaagcctatgggccgggtttggagaaatctggttgt
actatcaacaacccagcagagttcattgtggatcctaaggatgccgggagtgctccctta
aagatactggcgcaggatggggaaggccagcccattgacatccagatgaagagtcggatg
gacggcacttatgcttgctcatataccccacttaaagccatcaagcacaccatcgctgtg
gtctggggaggtgtgaacataccacacagcccctacagggtcaacattgggcaaggtagc
catccccaaaaggtcaaagtgtttggcccaggcgtggagaggagtggtctgaaggcaaat
gagcctactcactttacagtggattgcacggaggccggggaaggtgatgtcagtgttggt
atcaagtgcgatgcccgagttttaagtgacgatgaggaagatgtcgattttgacattatt
cacaatgccaatgacacattcactgtcaaatacgtacctcctgcccctgggcggtatacc
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccatgacgccagcaaggtgaaggcagaaggccccgggttgagtaaagcaggcgtg
gaaaatgggaagccaacccacttcactgttcacaccaagggagccggaaaagctccgctc
aacgtgcagttcagcagcccccttcctggggaggcagtgaaggacttggatatcattgat
aattatgactactcacatactgttaaatacaccccaacccagcagggcaacatgcaggtt
ctagtgacttatggtggcgatcccattcctaaaagtcctttcactgtgggcgttgctgcg
ccactggatctgagcaagataaaaattaatggactggaaaacagagttgaggttggaaag
gaccaggaatttgccattgacaccaacggggcaggaggccaggggaagctggatgtgacc
atcctgagcccttctcggaaggtggtgccatgcttggtagcaccagtggctggcagggaa
tgcagcacagccaaattcatccctcgggaggaggggctgtttgctgtagatgtgacctat
gatggacacccagtgcccgggagcccctatactgtggaggcctcactaccaccagatccc
accaaggtgaaggcccacggtcctggccttgaaggaggtcttgtaggcaagcccgctgag
ttcaccattgacactaaaggagctggaactggaggtttgggcctaactgtggaaggtcca
tgtgaggccaaaatcgaatgctcggataacggtgacgggacctgctccgtctcctacctt
cccacaaaacccggagaatactttgtcaacattctctttgaagaagtccacattcctgga
tctcccttcaaagccgacattgaaatgccgtttgacccctctaaggttgtagcgtcagga
ccaggacttgaacacggaaaagtgggtgaacccggaatcctttgcgttgattgttcagaa
gcagggcctgggactctgggccttgaagccgtctcagactcaggggcgaaagctgaagtg
tccatccagaacaataaagatggcacctacgctgtgacctatgtgcctctgacagctggc
atgtacacactgaccatgaagtatggtggtgagcttgtaccacactttcctgcctgggtc
aaggtggagccagccatagacactagtgggatcaaagcctttgggccaggaatcgaaggc
aaggacgtgtttcgggaggccacaacggacttcacggttgactcgaggccccttacccag
gttggaggtgaccatatcaaagctcaaattaccaacccctcgggggcctccaccgagtgc
tttgtcaaggacaatgctgatgggacctatcaggtcgaatacacgccctttgagaaaggt
ttccatgtagtggaggtgacatacgatgatgtgcccatcccaaatagcccattcaaagtg
gctgtcactgaaggctgccagccatctcgggtccatgcgcaaggccctggactgaaagag
gcgtttaccaacaaatctaatgtcttcacagtggtaaccaggggagcagggatcggtggg
cttggcataactgtggaggggccgtcggagtcaaagataaactgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccaggggattatgacgtcaatatcacg
tacggaggcgtccacatccctggcagccccttcagagttccttcaaaagatgttgtggat
cccagcaaggtcaagattgctggccccggtctgagctcctgtgtccgagcatgcatcccg
cagtccttcacagtggacagcagcaaggctggcctagctcccctggaagtgagggtcctg
ggcccaagaggcctcgtggagccggtgaatgtggtagataatggggacggcacccacaca
gtgacctacacgccatctcaggaggggccctacattgtttccgtcaaatatgctgatgaa
gagatcccccgaagtccctttaaggtcaaggttcttcccacatacgatgcaagcaaagtg
acagcctctgggcctggcctcagcgcctatggggtacccgccagcctacctgtggagttc
gccattgatgccagagatgctggcgaaggcctgcttgctgtccagatcacggaccaggag
ggaaagcctcaaagagctactgtccacgacaacaaagatggcacatatgccgttacctat
atccctgataagaccggacgctatatgattggagtcacctatggtggagacaacattcca
ctttctccttaccgtatccgggccacacagacaggcgatgccagcaagtgcttggccaca
ggtcctggtattgcccccactgtgaaaactggcgaggaggtgggctttgtagtggacgct
aagactgcagggaaggggaaagtaacctgcgtgattctgaccccagatggcaccgaggct
gaggctgacgtcattgaaaatgaagatggcacctatgacattttctacactgctgccaag
ccaggcacctatgttatctatgtgcgctttggtggcgttgatattcccaatagccccttc
acagtcatggccaccgatggggaagtcacagccatggaggaggcaccggttacagaagag
gcctatgtccctgtgagtgacatgaacgggctaggcttcaagccctttgacttggtgatt
ccatttgccgtcaggaaaggagaaattacaggcacggtgcatatgccttctgggaagaag
gctacacctgagattgtggacaacaaggacggcacggtcactgtgagatacgcgcccact
gaagtcggcctccacgagatgcacatcaagtacaggggcagccacatcccggagagcccc
ctgcagttctacgtgaactaccccaacagtgggagtgtgtctgcttatggtccaggcctt
gtgtatggagtagccaacaaaactgccaccttcaccattgtcacagaggatgcgggagaa
ggtggtctggacttggctattgaaggaccctcgaaagcagagatcagctgcattgacaac
aaagacgggacatgtacagtgacctacctacccaccttgccaggggactacagcattctg
gtcaagtacaatgacaaacatattcctggcagccccttcactgccaagatcacagatgat
aacagacgctgctcccaagtgaagctgggctcagctgctgacttccttctggacatcagt
gagacagaccttagcacactgacagccagtatcaaggccccatctggacgtgacgagccc
tgtctgctaaagaggctacccaacaaccacattggcatttccttcatcccccgagaagtg
ggtgagcatctagtcagcatcaagaaaaacggtaaccacgtggccaacagccctgtgtcc
attatggtggtccagtctgaaattggtgatgcacgccgagccaaagtctatggccaaggc
ctgtcagaaggccggacttttgagatgtcagacttcatcgtggacacaagagatgcaggc
tatggtggcatatccttggcagtagaaggacccagcaaggtggacatccaaacagaggac
ctggaggacggcacctgcaaggtgtcctacttccccactgtgcccggggtctatatcgtc
tccaccaaatttgctgacgagcatgtgcctggaagcccattcactgtgaagatcagtggc
gagggaagagtcagagagagcatcacccggaccagccgggctccggctgtggccacggtt
ggcagtatctgtgacctgaacctgaagatcccggagatcaacagcagtgacatgtctgcc
catgtcaccagcccctctggccatgtcactgaggcagagattgtgcccatgggaaagaac
tctcactgtgtcagatttgtgccccaggagatgggcgttcacactgtcagcgtaaagtac
cgcggacagcacgtaacaggaagcccgttccagttcaccgtggggccccttggcgaaggg
ggtgcccacaaggtccgggcaggaggccctggcctggagaggggagaagcaggcatccca
gctgagttcagcatctggacccgggaagcaggtgctggcggcctctccattgctgttgag
ggccctagtaaggccgagatcacattcgatgaccataaaaatgggtcatgcggtgtgtct
tatattgcccaagagcctggtaactacgaggtgtctatcaagttcaacgacgagcacatc
ccggacagcccttacctggtgcccgtcatcgcgccctcagacgacgctcgctgcctcact
gttctgagccttcaggaatcaggattaaaagttaaccagccagcgtcctttgctataagg
ttgaatggtgcgaaagggaagattgatgcaaaggtgcacagcccctcaggagccgtggag
gaatgccacgtgtctgaactggagccagataagtatgccgttcgcttcatcccgcatgag
aatggcatccacacgatcgatgtcaagtttaacgggagccacgtggtcgggagccctttc
aaagtacgtgtaggagagcctggccaggcaggcaatcctgctctagtgtcagcctacggt
gctgggcttgagacgggcaccacaggtatccaatcagaattcttcatcaataccactcag
gcaggcccagggacattatctgtcaccattgaaggaccatccaaggtcaaaatggattgc
caggaaatcccagaggggtacaaagtcatgtacactcccatggctcctggaaattacctg
attggtgtcaaatatggcgggcccaaccacatctcgaggagtccattcaaggccaaggtg
acaggccaacgtctggtcagcccaggctcagccaacgagacctcctccatcttggtggag
tccgtaaccagatcctcaacggaaacgtgctatagcgccattcccaagtcgtcctccgat
gccagcaaagtgacctccaagggcgcaggcctgtcaaaggcttttgtgggccagaagagt
tctttcctggtggactgcagcaaagctgggtccaacatgctgttgattggggtccatggg
cccaccaccccctgtgaagaggtctccatgaagcatgtgggcaagcaacagtacaacgtc
acctacgtcgtcaaggagaggggcgattacgttctggctgtgaagtggggggaagagcac
atccccggtagcccctttcatgtcaccgtgccttaa

DBGET integrated database retrieval system