KEGG   Mus musculus (mouse): 29818Help
Entry
29818             CDS       T01002                                 

Gene name
Hspb7, 27kDa, Hsp25-2, cvHsp
Definition
(RefSeq) heat shock protein family, member 7 (cardiovascular)
  KO
K09546  
heat shock protein beta-7
Organism
mmu  Mus musculus (mouse)
Brite
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   29818 (Hspb7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 D3
AA seq 169 aa AA seqDB search
MSHRTSSAFRAERSFRSSSSSSSSSSSSASRALPAQDPPMEKALSMFSDDFGSFMLPHSE
PLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTFNNHIEVRAEKLAADGTVMNT
FAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagccatcggacctcctccgccttcagagcggagagaagcttccgttcctcttcctcc
tcctcctcctcctcttcttcttcggcctcccgtgcccttccagcccaggacccacccatg
gagaaggctttgagcatgttttcagacgactttggcagttttatgctgccccactcggag
cccctggccttcccagcccgtcccgggggccaaggaaacatcaagaccctcggggatgcc
tacgagtttacagtggacatgagagacttctcccctgaagacatcattgtcaccaccttc
aacaaccacatcgaggtgcgggctgagaagctggcagctgatggcacagtcatgaacacc
tttgctcacaagtgccaactaccagaggatgtggacccaacatcggtgacctcggccctt
cgagaggatggtagcctcaccatccgggcgcggcgccacccccacacagaacatgtccag
cagaccttccggactgagataaaaatctga

DBGET integrated database retrieval system