KEGG   Mus musculus (mouse): 29857Help
Entry
29857             CDS       T01002                                 

Gene name
Mapk12, AW123708, Erk6, P38gamma, Prkm12, Sapk3
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05164  Influenza A
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    29857 (Mapk12)
   04010 MAPK signaling pathway
    29857 (Mapk12)
   04370 VEGF signaling pathway
    29857 (Mapk12)
   04668 TNF signaling pathway
    29857 (Mapk12)
   04068 FoxO signaling pathway
    29857 (Mapk12)
   04071 Sphingolipid signaling pathway
    29857 (Mapk12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    29857 (Mapk12)
   04218 Cellular senescence
    29857 (Mapk12)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29857 (Mapk12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    29857 (Mapk12)
   04620 Toll-like receptor signaling pathway
    29857 (Mapk12)
   04621 NOD-like receptor signaling pathway
    29857 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    29857 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    29857 (Mapk12)
   04660 T cell receptor signaling pathway
    29857 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    29857 (Mapk12)
   04659 Th17 cell differentiation
    29857 (Mapk12)
   04657 IL-17 signaling pathway
    29857 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    29857 (Mapk12)
   04670 Leukocyte transendothelial migration
    29857 (Mapk12)
  Endocrine system
   04912 GnRH signaling pathway
    29857 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    29857 (Mapk12)
   04917 Prolactin signaling pathway
    29857 (Mapk12)
   04926 Relaxin signaling pathway
    29857 (Mapk12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29857 (Mapk12)
  Nervous system
   04728 Dopaminergic synapse
    29857 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    29857 (Mapk12)
   04722 Neurotrophin signaling pathway
    29857 (Mapk12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29857 (Mapk12)
  Development
   04380 Osteoclast differentiation
    29857 (Mapk12)
  Environmental adaptation
   04714 Thermogenesis
    29857 (Mapk12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    29857 (Mapk12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    29857 (Mapk12)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    29857 (Mapk12)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    29857 (Mapk12)
  Infectious diseases
   05132 Salmonella infection
    29857 (Mapk12)
   05133 Pertussis
    29857 (Mapk12)
   05152 Tuberculosis
    29857 (Mapk12)
   05164 Influenza A
    29857 (Mapk12)
   05160 Hepatitis C
    29857 (Mapk12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    29857 (Mapk12)
   05169 Epstein-Barr virus infection
    29857 (Mapk12)
   05145 Toxoplasmosis
    29857 (Mapk12)
   05140 Leishmaniasis
    29857 (Mapk12)
   05142 Chagas disease (American trypanosomiasis)
    29857 (Mapk12)
  Drug resistance
   01522 Endocrine resistance
    29857 (Mapk12)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     29857 (Mapk12)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   29857 (Mapk12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like UvrD_C
Motif
Other DBs
NCBI-GeneID: 29857
NCBI-ProteinID: NP_038899
MGI: 1353438
Ensembl: ENSMUSG00000022610
UniProt: O08911
Position
15; 15 E3
AA seq 367 aa AA seqDB search
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
ITGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLERMLVLDAEQRV
TAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaagacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctactggatgtgttcacacctgatgagtctctggac
gacttcacagacttctacctggtgatgccattcatgggcactgatctgggcaaactcatg
aagcatgagaccctgagtgaagacagaatccagtttcttgtgtatcagatgttgaagggg
ctgaagtatatccatgcggctggtgtcatccacagagacttgaagcctggcaacctggct
gtgaatgaggactgtgagctgaagatcctagactttggccttgccaggcaggcagacagt
gagatgacaggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg
atgcgctacacgcagacagtggacatttggtccgttggctgcatcatggcggagatgatt
actgggaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaag
atcacagggacgccccctcctgagtttgttcagaagctacagagtgcagaggccaagaac
tacatggaaggcctccctgagttagaaaagaaggattttgcctctgtcctgaccaacgca
agccctcaggctgtgaatctcctggaaaggatgctggtgctggatgcggaacagcgggtg
acagcagctgaggcgttaacccatccatactttgagtcccttcgggacactgaggatgaa
cccaaggcccagaaatatgacgactcctttgatgatgtagaccgcacccttgaggaatgg
aagcgtgtgacttacaaggaagttctcagcttcaagcctcctaggcagctaggagccaga
gttccaaaggagacggctctgtga

DBGET integrated database retrieval system