KEGG   Mus musculus (mouse): 29875Help
Entry
29875             CDS       T01002                                 

Gene name
Iqgap1, AA682088, D7Ertd237e, D7Ertd257e, mKIAA0051
Definition
(RefSeq) IQ motif containing GTPase activating protein 1
  KO
K16848  
Ras GTPase-activating-like protein IQGAP1
Organism
mmu  Mus musculus (mouse)
Pathway
Adherens junction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    29875 (Iqgap1)
  Cellular community
   04520 Adherens junction
    29875 (Iqgap1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    29875 (Iqgap1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     29875 (Iqgap1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29875 (Iqgap1)
  Exosomal proteins of breast milk
   29875 (Iqgap1)
  Exosomal proteins of other body fluids (saliva and urine)
   29875 (Iqgap1)
  Exosomal proteins of colorectal cancer cells
   29875 (Iqgap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 D3; 7 45.68 cM
AA seq 1657 aa AA seqDB search
MSAAEEVDGLGVVRPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKIELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRVAADTFTAL
KNPNAMLVNLEEGLAPTYQDVLYQAKQDKMTNAKNRTENSDRERDVYEELLTQAEIQGNV
NKVNTSSALANISLALEQGCAVTLLKALQSLALGLRGLQTQNSDWYMKQLQSDLQQKRQS
GQTDPLQKEEVQAGVDAANSAAQQYQRRLAAVAAINAAIQKGIAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQQQSPEHSLTHPELTVAVEMLSSVALINRALESGDMTTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNAFITWNDIQACVDHVNLVVHEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQETQDESAV
LWLDEIQGGIWQSNKDTQEAQRFALGISAINEAVDSGDVGRTLSALRSPDVGLYGVIPEC
GETYQSDLAEAKKKRLAAGDNNSKWVKHWVKGGYHYYHNLETQAGGWAEPPDFVQNSVQL
SREEIQSSISGVTAAYNREQLWLANEGLITKLQACCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLHSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMIVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFQTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALSHEEVKTRLDNSIRNMRA
VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
KFRRFFQVACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESCGNSNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATNEQEAEHQRAMQRRAIRDAKTPDKMKK
SKPMKEDNNLSLQEKKEKIQTGLKKLTELGTVDPKNRYQELINDIAKDIRNQRRYRQRRK
AELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcggaggaggttgatggcctgggtgtggtccggccgcactatggctccgtc
ctggataatgagaggctcactgcagaggagatggatgagcggagacggcagaacgtggct
tatgaatacctttgtcatctggaagaagcaaagaggtggatggaagcatgcctaggtgag
gacctgccgcccaccacagagctagaggagggccttagaaacggagtctaccttgccaag
ctagggaacttcttctctcccaaagtggtgtccctgaagaaaatctatgatcgagaacag
accagatacaaggctaccggcctccacttcagacacacggataatgtgattcagtggctg
aatgccatggatgagattgggttgcctaagattttttacccagaaaccacagatatctat
gaccggaagaacatgccaagatgcatctactgtatccacgccctcagtttgtacctgttc
aaactgggcctggctcctcagattcaagacctgtatggaaaggttgatttcacagaagaa
gaaatcaacaacatgaagatcgagctggagaagtacgggatccagatgcctgccttcagc
aagatcgggggcatcctggctaatgagctctcagtggatgaagctgcgctacatgctgct
gttattgctattaatgaagcgattgatcgcagagttgcagctgacacttttacggctcta
aaaaaccccaatgccatgctcgtcaatcttgaagaaggcctggctcccacgtaccaagac
gtgctttaccaggccaagcaggacaagatgacaaacgctaaaaacaggacggaaaactct
gacagagaaagggacgtttatgaggagctgctcacacaagctgaaatccaagggaatgta
aacaaagtcaacacatcttctgccctggccaacatcagcctggctttagagcagggctgt
gcagtgaccctgctcaaggctctgcagtcactggctctgggcctccgagggctgcagacc
cagaacagcgactggtacatgaagcagctacagagtgatctgcagcaaaagagacagagt
ggccagactgaccccctgcagaaggaggaggtacaggccggagtggatgctgccaacagt
gctgcccagcagtaccaacgacggttggcagcagtggcagcaatcaacgctgccatccag
aagggcatcgctgagaagaccgtgttggagctaatgaatcctgaagcccagctgccccag
gtgtatccatttgcagctgatctctatcagaaggagttggccaccctgcagcagcagagc
cctgagcatagcctcacccatcctgagctcactgttgctgtggagatgctgtcatccgtg
gccctcatcaacagggcgctggagtcaggagacatgaccactgtgtggaagcagctgagc
agctcagttacgggccttaccaacatcgaggaagaaaactgtcaaaggtatctcgatgag
ctgatgaagctgaaggctcaggcacatgccgagaataatgcatttattacatggaatgac
atccaggcgtgtgtggaccatgtgaacctggtggtccatgaggagcatgagcggattttg
gccatcggcttgattaatgaagccctggatgaaggggacgctcagaagactctgcaggcc
ctgcagatccctgcagccaagctcgagggcgtccttgcagaagtggcacagcactatcaa
gacacgctgatcagagcaaagagagaaaaggcccaggaaacacaggatgagtcagctgtg
ttatggttggatgaaattcaaggtggaatctggcagtccaacaaagacacccaagaggcc
cagaggtttgccttaggaatctctgccatcaatgaagcagtagacagcggtgatgttggc
agaaccctgagtgccctacgttctcccgacgttggcttatatggagtgatccccgaatgt
ggggaaacgtaccagagtgaccttgctgaagccaagaagaagagactggcagcaggagat
aataacagcaagtgggtgaagcactgggtgaaaggcgggtaccattactaccacaacctg
gagacgcaagcaggaggatgggctgagcccccagactttgtgcagaattctgtgcagctt
tctcgagaggagatccagagctccatctctggagtaaccgctgcatataaccgagagcag
ctttggctggccaacgaaggcttgatcaccaagctgcaagcctgctgccgtgggtacctc
gttcgacaggaattccgatcccggatgaattttctgaagaaacagatccctgccatcacc
tgcattcagtcacagtggagaggatacaaacagaagaaggcatatcaagatcggctggct
tacctgcactcccataaagacgaagttgtgaagattcagtcccttgccaggatgcatcaa
gctcgaaagcgctatagagatcgcctacagtatttccgagaccatataaatgacattatc
aaaatccaggctttcattcgggccaacaaagctcgtgatgactacaagactctcatcaat
gctgaggacccgcctatgattgtggtccgaaagtttgtccacctcctggaccaaagtgat
caggacttccaggaggaacttgatctcatgaagatgcgcgaggaggtcatcaccctcatc
cgttccaaccagcagctggagaacgacctcaacctcatggatatcaaaatcggactgctg
gtgaagaacaagatcacgctgcaggatgtggtttcccatagtaaaaaacttaccaaaaaa
aataaggaacagctgtccgacatgatgatgataaacaagcagaagggcgggctcaaggct
ttgagcaaagagaagagggagaagctggaggcctatcagcatctcttttatctcctgcag
accaaccctacctatctggccaagctgatctttcagatgccacaaaacaagtccaccaaa
ttcatggactctgtgatcttcacgctgtacaactatgcatctaaccagcgggaggagtac
ctgctgctgcggctcttccagacagctctgcaggaggagatcaagtcaaaggtggatcag
attcaagaaatcgtgacaggaaaccctacggttattaagatggttgtaagtttcaaccgt
ggtgcccggggccagaatgccctccggcagatcttggcccctgtcgtgaaggaaattatg
gatgacaagtctctcaacatcaaaaccgaccctgtggatatttacaagtcttgggttaat
cagatggagtcgcagacaggagaggcgagcaaactgccctatgatgtgactcctgaacaa
gccttgtctcatgaagaagtgaagacgaggttagacaactccatcaggaacatgagggcc
gtgacagacaagttcctctcagccatcgtcagctctgtggacaaaatcccttatgggatg
cgcttcattgccaaagtcctgaaggattccctgcacgagaagttccctgacgctggtgag
gacgagctgctgaagattatcggtaacctgctttactaccgatacatgaacccagccatc
gtcgctcccgatgccttcgacatcattgacctgtcagcagggggccagctcaccacagac
cagcgcagaaacctgggctccattgccaagatgctccagcacgcggcgtccaacaagatg
tttctgggcgataatgcccacttaagcatcattaatgagtatctctcgcagtcctaccag
aaattcagacggtttttccaagtggcttgtgacgtcccagagctgcaggataaatttaac
gtggatgagtactctgacctagtcaccctcactaagccagttatctacatctccattggc
gaaatcatcaacacccacactctcctgttggaccatcaggatgccattgctccagagcat
aacgaccccatccacgaacttctggacgaccttggggaggtgcccaccattgagtccctt
ataggagaaagctgtggcaattcaaacgaccccaacaaggaggctctggctaagacggaa
gtgtctctcacgttgaccaacaagtttgacgtgcctggtgacgagaacgcagagatggac
gctcggaccatcttactgaatacaaaacgtttaattgtggatgtcatccggttccagcca
ggagagaccttgactgaaattctagaaaccccagccaccaatgaacaggaagctgaacat
cagagggccatgcagagacgggctatccgcgatgccaaaacccctgacaagatgaaaaaa
tcaaagcccatgaaggaggataacaacctcagcctccaggagaagaaagagaagatccag
actggcctaaagaagctaacggagcttgggacggtggacccaaagaacagataccaggaa
ctcatcaacgacattgccaaggatatccggaatcagcggagatacaggcagaggaggaaa
gctgaattggtaaaactgcagcagacgtactcggcgctgaactctaaggccaccttttac
ggcgagcaggtggactactacaagagctacatcaaaacctgcttggataacttggccagc
aagggcaaggtctccaaaaagcctagggaaatgaaaggcaagaaaagcaaaaagatttct
ctgaagtacacagcagcgaggctgcatgagaagggcgtccttctggagattgaagacctt
caggcaaaccaatttaaaaatgttatcttcgaaattggtccaacagaagaagttggagac
tttgaagtaaaagccaagttcatgggagttcagatggagactttcatgttgcattatcag
gacttgctgcagctacagtatgaaggagttgcagttatgaaattatttgatagagctaaa
gtgaatgtcaacctcctgatcttccttctcaacaaaaagttctatgggaagtaa

DBGET integrated database retrieval system