KEGG   Mus musculus (mouse): 30049Help
Entry
30049             CDS       T01002                                 

Gene name
Scd3, 4930513N16Rik
Definition
(RefSeq) stearoyl-coenzyme A desaturase 3
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    30049 (Scd3)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    30049 (Scd3)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    30049 (Scd3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     30049 (Scd3)
Lipid biosynthesis proteins [BR:mmu01004]
 Desaturase
  First
   30049 (Scd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 30049
NCBI-ProteinID: NP_077770
MGI: 1353437
Ensembl: ENSMUSG00000025202
UniProt: Q99PL7
Position
19; 19 C3
AA seq 359 aa AA seqDB search
MPGHLLQEEMTPSYTTTTTITAPPSGSLQNGREKVKTVPLYLEEDIRPEMKEDIYDPTYQ
DEEGPPPKLEYVWRNIILMALLHVGALYGITLVPSCKLYTCLFAFVYYVISIEGIGAGVH
RLWSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGILLMCFILPTLVPWYCWGE
TFLNSFYVATLLRYAVVLNATWLVNSAAHLYGYRPYDKNIDPRQNALVSLGSMGEGFHNY
HHAFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKRVSKATVLARIKRTGDGSHKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccagggcacctgctgcaagaagagatgacgccttcgtacacgaccaccaccaccatc
acagcgcctccctctggaagcctgcagaatggacgagagaaggtgaagacggtgcccctc
tacctggaagaagacatccgtcctgaaatgaaagaagatatatacgaccccacctatcag
gatgaggaggggcccccgcccaagctggagtacgtctggaggaacatcattctcatggcc
ctgctgcacgtgggagccctgtacgggatcacactggttccctcctgcaagctctacacc
tgcctcttcgcgtttgtctactatgtgatcagtattgagggcattggagccggagtccat
cgcctgtggagccacagaacgtacaaggcacgcctgcccctgcggatcttcctcatcatt
gccaacaccatggcgttccagaatgacgtgtatgaatgggcccgagatcaccgagcccac
cacaagttctcagaaacacacgccgaccctcacaattcccgccgtggcttcttcttctct
cacgtgggttggctgcttgtgcgcaaacacccggctgtcaaagagaagggcggaaaactg
gacatgtctgacctgaaagccgagaagctggtgatgttccagaggaggtactacaagcct
ggcattctgctgatgtgcttcatcctgcccacgctggtgccctggtactgctggggcgag
acttttctaaacagtttttatgttgccactttactgagatacgctgtggtgctcaacgcc
acttggctggtgaacagtgccgcccacctctacgggtatcgcccctacgataagaacatc
gatccccggcagaatgccctggtttccttgggaagtatgggcgagggcttccacaactac
caccatgccttcccctacgactactctgccagtgagtaccgctggcacatcaacttcacc
acgttcttcatcgactgcatggctgcactgggcctggcttacgaccggaagagagtgtcc
aaggccactgtcttagccaggattaagagaactggagacgggagtcacaagagtggctga

DBGET integrated database retrieval system