KEGG   Mus musculus (mouse): 30925Help
Entry
30925             CDS       T01002                                 

Gene name
Slamf6, KAL1, KAL1b, Ly108, NTB-A, NTBA, SF2000
Definition
(RefSeq) SLAM family member 6
  KO
K16852  
SLAM family member 6
Organism
mmu  Mus musculus (mouse)
Brite
Cellular antigens [BR:mmu04090]
 Proteins
  30925 (Slamf6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H3; 1 79.54 cM
AA seq 331 aa AA seqDB search
MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGVLGESAVLPLKLPAGK
IANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGS
YTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVE
WQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWNA
VWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPESSQSTDGPGSPGNTVYAQVTR
PMQEMKIPKPIKNDSMTIYSIVNHSREAEYS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctcaagggctccagcacccgactccgcctgtcagaggatggtctggctcttt
ccacttgtcttctgcctcggctcagggagtgaagtttcacagagcagctcagacccccag
ctaatgaatggcgttctaggagagtctgcagttcttcctctaaagcttcctgcagggaag
atagccaatatcatcatctggaattatgaatgggaagcgtcacaagtcactgccctcgtt
atcaacctaagtaatcctgaaagtccacaaatcatgaacactgatgtaaagaagagactg
aacatcacccagtcctactccctgcaaatcagcaaccttaccatggcagacacaggatca
tacactgcgcagataaccacaaaggactctgaagtgatcaccttcaaatatattctgagg
gtctttgaacgactgggtaacttagaaactaccaactatactctcctgctagagaatggg
acctgccagatacacctggcctgtgttttgaagaatcaaagtcaaactgtctcagttgag
tggcaagccacaggaaacatctctttaggaggaccaaatgtcactatcttttgggacccg
aggaattctggtgaccagacttacgtctgcagagccaagaatgctgtcagcaatttgtca
gtctctgtttcgacccagagtctctgcaaaggggttctaactaatccaccctggaatgca
gtatggtttatgactacaatttcaataatcagtgctgtcatactcatctttgtgtgctgg
agcatacatgtttggaagagaagaggttctcttcctttgactagccaacatccagagtcc
tcccagagcacagatggcccaggctctccagggaacactgtgtatgcacaagtcactcgt
ccaatgcaggaaatgaaaatcccaaaacctatcaaaaatgactccatgacaatttactcc
atagttaatcattccagagaggccgaatactcttaa

DBGET integrated database retrieval system