KEGG   Mus musculus (mouse): 30940Help
Entry
30940             CDS       T01002                                 

Gene name
Usp25
Definition
ubiquitin specific peptidase 25 (EC:3.4.19.12)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     30940 (Usp25)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   30940 (Usp25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
16 C3.1; 16
AA seq 1055 aa AA seqDB search
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDAQILQQALKDSNGNLELAVAFLTAKNAK
TPPQEETGYYQTALPGNDRYISVGSQADANVIDLTGDDKDDLQRAIALSLAESNRAFRET
GITDEEQAISRVLEASIAENKACLKRTPIEVWRDSRNPYDRKRQEKAPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYV
DPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFY
GRFLAMGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSDNSGKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSSASG
PLPSQSLPSTTEQQGPCASDLPGSSSPASGAALPLRSVIHKPFTQSRIPPDLPMHPAPRH
ITEEELCVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVH
EGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYIDDKA
QFLIQEEFNKETGQALVGMETLPPDLRDFVEEDNQRFEKELEEWDTQLAQRSLQEKLLAA
PKLREAEASATTAQAGGADYLEQPSRSDLSKHWKEETLRVIAKASHDLEDKGPETVLQSA
IKLEYSRLVKLAQEDTPPETDYRLHHVLVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERC
HNIMKVAQAKLEMIKPEEVNLEEYEEWHADYKKFRETTMYLITGLENFQRESYIDSLLFL
LCAYQNNKELLSKGPYRGHDGELISHYRRECLLKLNEQAAELFESGEDGDVNNGLIIMNE
FIVPFLPLLLVDDMEEKDILAVEDMRNRWCSYLGQEMEANLQEKLTDFLPKLLDCSTEIK
GFHEPPKLPSYSAHELCERFARIMLSLSRTPADGR
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaatgtgctgcagcagagcgcggcgcagaagcaccagcagacattt
ttgaatcagctgagagaaattactgggattaatgacgcccagatactccaacaagccctg
aaggatagtaacggaaacttggaattagcagtagccttcctcactgcaaagaatgccaag
acccccccacaggaggagacaggctattaccagacagcgcttccaggcaacgacaggtac
atcagcgtgggaagccaggcagatgcaaatgtaattgatctcactggagatgacaaagat
gatcttcagagagcgattgccttgagtttggcggagtcaaacagggcattcagggagacg
ggcataaccgatgaagagcaggccatcagtagagttcttgaagccagcatagcagaaaat
aaagcatgcttgaagagaacacctatagaagtttggagggattctcgaaacccctatgac
agaaaaagacaagagaaagctccagtcggtctgaagaatgtcggcaacacctgctggttt
agtgcagttattcagtcattattcaatcttttggagtttagaagattagttctgaattac
aagcctccatcaaatgctcaagatttaccccgaaaccaaaaggaacatcggaatttgcct
tttatgcgggaactgaggtatctgtttgcacttcttgttggtaccaagaggaagtatgtt
gatccgtccagagcagttgagattctgaaggatgccttcaaatccaatgactcacagcag
caagatgtgagtgagtttacacacaagttattggactggttggaagatgccttccaaatg
aaagctgaagaggaaacggatgaagagaagccaaagaaccctatggtagagctgttctat
ggaagattcctagccatgggagtgcttgaaggaaaaaaatttgagaacactgaaatgttc
ggtcagtatccacttcaggtgaacgggttcaaagacctgcatgagtgcctggaggccgcc
atgatcgaaggggagatcgaatccttacactccgataactcaggaaagtcaggccaggag
cattggttcactgaattgccgccggtattaacatttgaactgtcaagatttgaatttaac
caggcattgggaagaccagaaaaaattcacaataaactagaatttccccaagttttatat
ctggacaggtatatgcacagaaatagagaaataacaagaattaaacgtgaagagatcaag
agacttaaagattacctcacagtattacaacaaagattagagagatatttaagctatggt
tccggtcccaaaagattcccattggtagatgttctacagtatgcattggagtttgcctcc
agtaaacctgtgtgcacttcccccgttgatgacatcgatgctagttcctcagcaagtggc
cccctaccatcacagtccttaccaagcacaacagaacagcagggaccctgtgcttcagat
ctgcccggctcctcctcacccgcatcaggtgccgccctgcccttgaggtcagtgattcac
aaacccttcactcagtctcggatacctccagatttgcccatgcatccggcaccaaggcac
atcacagaggaagaactgtgcgtgctggagagctgtttacatcgctggaggacggaaata
gaaaatgacacgcgagatctgcaggaaagcatatccagaatccatcgaacaattgaactc
atgtactcggacaaatccatgatccaagtcccttaccgcctccatgccgtcctagttcat
gagggccaggctaatgccggccactactgggcgtacatctttgaccaccgggagagccgg
tggatgaagtataatgatattgctgtgaccaagtcttcatgggaagagctagtgagggac
tctttcggtggttatcgaaatgccagtgcatactgcttaatgtacatagacgacaaggca
cagttcctaatacaagaggagtttaataaagagactgggcaggcccttgttggaatggaa
accttacctccagacttgagagactttgttgaggaggacaaccagcgctttgagaaggaa
ctggaagaatgggacacgcagcttgcccaacgatcactgcaagaaaagctgctagctgcg
ccgaaactgcgggaagcagaggcttcggccaccacagcacaagcaggaggcgcagactat
ctagagcagccatcaagaagtgacttgtcaaagcactggaaagaagaaacgctccgagtg
attgccaaggcgtcacatgatcttgaagataaagggccagagacagttttgcagtcggca
attaaattagagtattctaggctggttaagttggcccaagaagatactccaccagaaaca
gattatcgtttacatcatgtcctggtctactttatccagaaccaggcaccaaagaaaatc
attgagaaaacattactcgaacaatttggagatagaaatttgagttttgatgaaaggtgt
cacaacataatgaaagttgcccaagccaaactggaaatgatcaaacctgaagaagtgaac
ttggaagaatatgaggagtggcatgcagattataagaaattccgagaaacaactatgtat
ctcataactggactagaaaactttcagagagaaagttatatagactccttgctgttcctt
ctctgtgcttatcagaataacaaagagctcttgtctaagggtccgtacagaggccacgat
ggggagctgatatcacattacagaagagagtgcttactgaaattaaacgagcaagcggcc
gagctgtttgagtctggagaggacggagacgtgaacaatggcttaattattatgaatgag
tttatcgttccctttctgcccttgttgctggtggatgacatggaagagaaagatatcctt
gctgtggaagacatgaggaatcgctggtgttcatacctggggcaagaaatggaagcaaac
ctccaagaaaagctcacggattttctgccaaaactgcttgattgttctacagagattaaa
ggtttccacgagccaccaaagttaccttcctactctgcgcacgaactctgtgagcgattc
gcccggatcatgttgtccctcagtcgtacgcctgctgatggaagataa

DBGET integrated database retrieval system