KEGG   Mus musculus (mouse): 30957Help
Entry
30957             CDS       T01002                                 

Gene name
Mapk8ip3, BB120594, D17Wsu15e, JIP-3, JSAP1, JSAP1a, JSAP1b, JSAP1c, JSAP1d, Jip3, Syd2, mKIAA1066
Definition
(RefSeq) mitogen-activated protein kinase 8 interacting protein 3
  KO
K04436  
mitogen-activated protein kinase 8 interacting protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    30957 (Mapk8ip3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 A3.3; 17 12.53 cM
AA seq 1337 aa AA seqDB search
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGSGQTESSLPGRSRKERPTSLNVFPLADGMVRAQMGGKLVPAGDHWHLSDLG
QLQSSSSYQCPNDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYV
SVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRL
ERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKE
VGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKEL
EEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYK
ERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIH
YKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDG
RLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAAGVNLSGWK
PHEEDSSNGPKPVPGRDPLTCDREGEGEPKSTHPSPEKKKAKETPEADATSSRVWILTST
LTTSKVVIIDANQPGTIVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDSGA
DGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGDVATTANGKVNPSQSTEEATEAT
EVPDPGPSESEATTVRPGPLTEHVFTDPAPTPSSSTQPASENGSESNGTIVQPQVEPSGE
LSTTTSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADG
TLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVNDRVWCGYKNKVHVIQPKTMQIEK
SFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGK
LGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTR
PGGIIHVYGDDSSDKAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLD
SPSEGPGPAAPAADAEGQKLKNALVLSGGEGYIDFRIGDGEDDETEECAGDVNQTKPSLS
KAERSHIIVWQVSYTPE
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgatggagatccagatggacgagggaggaggagtggtggtgtaccaagacgactactgc
tcgggctcggtcatgtcggagcgtgtgtcgggcctggcgggctccatctaccgcgagttc
gagcgcctcattcactgctatgacgaggaggtggtcaaggagctcatgccgctggtggtg
aacgtgctggagaaccttgactcggtgctgagcgagaaccaggagcacgaggtggagctg
gagctcctacgcgaggacaacgagcagctgctcacgcaatacgagcgcgagaaggcgctg
cgcaaacaggccgaggagaaattcatcgaatttgaagatgccttggaacaagagaagaaa
gaactccagatccaggtagaacattatgagtttcagacacgccagctggagctaaaggcc
aaaaactatgcagatcagatttcccgactggaggaacgagaatcggagatgaagaaggaa
tacaatgccctgcaccagcggcacacagagatgatccagacctatgtggaacacattgaa
agatccaagatgcagcaagttgggggtagcggccaaacagaaagcagcctgcccgggcgg
agcaggaaggagcgtcccacctctctgaatgtcttccccctggctgatggcatggtacgt
gcacagatggggggcaagctcgtgcctgcgggggaccactggcacctgagtgacctcggc
cagctacagtccagctccagctaccagtgtccaaatgatgagatgtctgagtcaggccag
tcctcagcagctgcaacacccagtaccacaggtaccaagtccaacacacccacgtcctcc
gtgccctcagcagcagtcacgccactcaacgagagcctacagcccctgggggactatgtc
agtgtcacaaagaacaacaagcaggcccgagagaagcgcaatagccgtaacatggaggtc
caggtcacccaagagatgcggaacgtcagtatcggcatgggcagcagtgacgagtggtcc
gatgttcaggacattatcgactccaccccagagctggatgtgtgtcctgaaacccgtctg
gagcgcacaggaagcagcccaacccagggaattgtaaacaaagcttttggaatcaacact
gactccttgtatcacgaactctccacggcgggatctgaggtcatcggggatgtggacgag
ggagctgatctcctaggggagttttcagtgcgcgatgatttttttggaatgggcaaagaa
gtggggaacctgctgctggagaactcacagcttctagagacaaaaaatgctttaaatgta
gtgaagaatgacctcattgctaaggttgaccaactgtcaggagaacaggaggtcctgaag
ggtgagctggaagcagccaagcaagccaaagtcaagctggagaaccgaatcaaagagctt
gaagaagaactgaagagagtcaagtcagaggcagtaactgcccgccgtgagcccagagaa
gaggtggaggatgtaagcagctatctctgtacagaattggacaaaatccccatggcccag
cgccgacgcttcacacgggtggagatggcccgagtgctcatggaacgcaaccagtacaag
gaacgcctcatggagctgcaggaggctgtgaggtggactgaaatgatcagagcatcaagg
gaacacccatctgtccaggagaagaagaagtccaccatctggcagttctttagtcgcctc
ttcagctcctcatctagcccccctccggccaaacgatcctacccatctgtgaacattcac
tacaagtcacccactgcagctggctttagccagcgtcgcagccatgctttgtgccagatc
tcagccggcagcaggcccctggagttcttccctgatgatgactgcacctcttctgcccgg
cgggagcagaagcgggagcagtaccgccaggttcgtgaacacgtgcgcaatgatgacggg
aggctgcaggcctgtgggtggagcctgcctgccaagtacaagcagctgagccccaatgga
ggccaggaagacacccggatgaaaaatgtgcctgtccctgtgtactgccgccctctggtg
gagaaggacccttcgacaaagctgtggtgtgctgctggtgtcaacctgagtgggtggaag
ccacatgaagaggactctagcaatggacccaagcctgtaccaggtcgagaccctctgacc
tgtgaccgggaaggagaaggcgaacccaagagcacacacccatcacctgagaagaagaag
gcaaaggaaacccctgaggcagatgctacctccagtcgggtatggatcctcaccagcacc
ctgacaaccagcaaggtggtgatcattgatgccaaccagccaggcacaattgtggatcag
ttcacagtctgcaatgcccacgtcctgtgtatctccagcattcctgcggccagtgacagt
gactatccccctggggagatgttcctagacagtgatgtgaaccctgaagattcaggtgct
gatggtgtgctggctggcatcaccctggtggggtgtgctacccgctgcaatgttccacgt
agcaactgttcctcacgaggagacaccccagtactggacaaggggcagggggatgtggcg
accactgccaatgggaaggtcaacccgtcccaatccacagaagaagccacagaagccacg
gaggtgccagaccctggtcccagcgagtcagaagcaacgacagtccggcccgggcctctc
acagagcatgtctttactgacccagcacccaccccatcctccagcacccagcctgccagt
gagaatgggtcagagtccaatggcaccattgtacagcctcaggtggagcccagtggggaa
ctctcaacaacaaccagtagcgctgcacccactatgtggctaggagcccagaatggctgg
ctctatgtgcattcagcggtagccaactggaagaagtgtctgcactccatcaagctaaaa
gactctgtgctgagcctggtgcatgtcaaaggccgagtgctggtagctcttgcagatggg
accctggctatcttccatcgtggagaggatggccagtgggacctgagcaactaccaccta
atggacctgggccacccacaccactccatccgctgcatggctgttgtgaatgaccgagtt
tggtgtggctacaagaacaaggtgcatgttatccagcccaagacaatgcagattgagaaa
tcatttgatgcccacccaaggcgggaaagccaggtacgtcagctggcctggatcggtgat
ggagtgtgggtctctattcgcttggattctacccttcggctctaccatgctcacacccac
cagcacctgcaggatgtggacattgagccctatgttagcaagatgctaggaaccggcaag
ctgggcttctccttcgtgcgcatcacagccttactcattgcaggcaaccgtctgtgggtg
ggcactggcaatggggttgtcatctccatccccttgactgagactgtggtcctgcatcga
ggccagctcctagggctccgagccaacaagacatccccaacatctggggaggggacccgc
ccagggggcatcatccatgtgtatggggacgacagcagtgacaaggccgccagtagtttc
atcccctactgctccatggcacaggctcagctttgcttccatgggcaccgtgatgctgtc
aaattctttgtctctgtgccaggaaatgtgctggccactctcaatggcagtgtgctagac
agcccatcagagggccctgggcctgctgcacccgctgcagatgctgagggccagaagttg
aagaatgcactggtgctgagtggtggtgaaggttacattgacttccgtatcggagacgga
gaggatgatgaaactgaggaatgtgccggggacgtgaaccagacaaagccctcgttgtcc
aaggctgagcgcagccacatcatcgtgtggcaggtgtcctacacccctgagtga

DBGET integrated database retrieval system