KEGG   Mus musculus (mouse): 319177Help
Entry
319177            CDS       T01002                                 

Gene name
Hist1h2ba, Th2b
Definition
(RefSeq) histone cluster 1, H2ba
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    319177 (Hist1h2ba)
  Immune diseases
   05322 Systemic lupus erythematosus
    319177 (Hist1h2ba)
  Substance dependence
   05034 Alcoholism
    319177 (Hist1h2ba)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    319177 (Hist1h2ba)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319177 (Hist1h2ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like FMN_bind
Motif
Other DBs
NCBI-GeneID: 319177
NCBI-ProteinID: NP_783594
MGI: 2448375
Ensembl: ENSMUSG00000050799
Vega: OTTMUSG00000000590
UniProt: P70696
Structure
PDB: 

Jmol
Position
13; 13 A3.1
AA seq 127 aa AA seqDB search
MPEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtggcggtaaagggtgctactatttccaagaaaggcttcaagaaagcggtc
accaagacccagaaaaaggagggccggaaacgtaagagatgccgcaaggagagctactcc
atttacatctataaggtgctgaaacaagtgcaccccgacaccggcatctcctccaaggcc
atgagcatcatgaactcctttgtgacagacatcttcgagcgcatcgcgagcgaggcgtcc
cgcctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtg
cgcctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggccgtc
accaagtacaccagctccaagtga

DBGET integrated database retrieval system