KEGG   Mus musculus (mouse): 319179Help
Entry
319179            CDS       T01002                                 

Gene name
Hist1h2be
Definition
(RefSeq) histone cluster 1, H2be
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    319179 (Hist1h2be)
  Immune diseases
   05322 Systemic lupus erythematosus
    319179 (Hist1h2be)
  Substance dependence
   05034 Alcoholism
    319179 (Hist1h2be)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    319179 (Hist1h2be)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319179 (Hist1h2be)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 319179
NCBI-ProteinID: NP_001171124
MGI: 2448380
Ensembl: ENSMUSG00000047246
Vega: OTTMUSG00000000563
UniProt: Q6ZWY9
Position
13; 13 A3.1
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccagccaagtccgctcccgccccgaagaagggctccaagaaggctgtcacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcaccccgacaccggcatctcctccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc
ctggcgcattacaacaagcgctcgaccatcacatcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system