KEGG   Mus musculus (mouse): 319182Help
Entry
319182            CDS       T01002                                 

Gene name
Hist1h2bh, H2b-221
Definition
histone cluster 1, H2bh
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    319182 (Hist1h2bh)
  Immune diseases
   05322 Systemic lupus erythematosus
    319182 (Hist1h2bh)
  Substance dependence
   05034 Alcoholism
    319182 (Hist1h2bh)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319182 (Hist1h2bh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A2-A3; 13
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKALTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcccgccaagtccgctcctgccccgaagaagggctccaagaaggccctgacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcaccccgacaccggcatctcctccaaagccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtcggagggcaccaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system