KEGG   Mus musculus (mouse): 319197Help
Entry
319197            CDS       T01002                                 

Gene name
Gpr4
Definition
(RefSeq) G protein-coupled receptor 4
  KO
K04312  
G protein-coupled receptor 4
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   GPR
    319197 (Gpr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A3
AA seq 365 aa AA seqDB search
MDNSTGTGEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQHNELGVYLMN
LSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLA
VAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMERWV
AWMNLYRVFVGFLFPWALMLLCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFA
PYHALLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVA
KALHNLLRFLASNKPQEMANASLTLETPLTSKRSTTGKSSGAVWAVPPTAQGDQVPLKVL
LPPAQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacaacagcacgggcacaggggagggctgccatgtggactctcgagtggaccacctc
ttcccaccatctctctacatcttcgtcatcggggtggggctgcccaccaactgcctggcc
ctgtgggcagcctaccggcaggtgcgccaacacaatgagctgggcgtctacctgatgaac
ttgagcattgcagacctgctgtacatctgcactttgccgctgtgggtcgactacttcctc
caccatgacaactggatccacggccctggctcctgcaagctctttggcttcatcttctac
agcaacatctatatcagcatcgccttcctgtgctgcatctccgtggaccgctacctggct
gtggctcatcctctgcgctttgcacgcctgcgccgggtcaagacagcagtggctgtgagc
tctgtggtctgggccacggagctgggcgccaattcagcaccgctcttccatgatgagctg
tttcgtgatcgctacaaccacaccttctgctttgagaagttccccatggagcgttgggtg
gcctggatgaatctgtaccgcgtctttgtgggcttcctcttcccctgggcactcatgttg
ctgtgctaccgtggcatcctgagggcagtgcagagcagtgtgtccaccgagcgccaggag
aaagtcaagatcaaacgtctggccctgagcctcatcgccattgtgctggtgtgctttgcg
ccttaccatgctctcctgctgtctcgcagcgccgtctacctgggccggccctgggactgt
ggcttcgaggagcgagtcttttctgcctaccacagctccctggccttcaccagcctcaat
tgtgtggctgaccccatcctctactgcctggtcaacgagggtgcccgcagtgatgtggcc
aaggccctgcacaacctcctccgcttcctggccagcaacaagccccaggagatggccaat
gcttccctcaccctggagacacccttgacctccaagaggagcaccaccggcaagtcgtcc
ggggctgtctgggcagtgcctccgactgcccagggggaccaggtgccactgaaggtgctg
ctgcccccggcacagtga

DBGET integrated database retrieval system