KEGG   Mus musculus (mouse): 319239Help
Entry
319239            CDS       T01002                                 

Gene name
Npsr1, 9330128H10Rik, GPRA, Gpr154, MVTR, PGR14, VRR1
Definition
(RefSeq) neuropeptide S receptor 1
  KO
K08376  
neuropeptide S receptor 1
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide S
    319239 (Npsr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 A3-A4
AA seq 371 aa AA seqDB search
MPANLTEGSFHANQTVPMLDSSPVACTEIVTFTEALVAEEWGSFYSSFKTEQLITLWVLF
VVTIVGNSVVLFSTCRRKRKSRMTFFVTQLAITDSFTGLINILTDIIWRFTGDFMAPDLV
CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQAKVLIGIAWSLSFLFSIP
TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLAIISVIYGLVIRTIWMK
SKTHETVISNCSDGKLCCSYNRGLISKAKIKAIKYSIVIILAFICCWSPYFLFDILDNFN
VLPDTKERFYASVIIQNLPALNSAINPLIYCIFSSSICSPCKMQRSQDSRMTYRERSERH
EMQILSKPEFI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaacctcacagagggcagctttcatgccaaccagactgtgccgatgctagat
tcttccccagtagcttgcactgaaattgtgacgttcactgaagcactggtggctgaggag
tggggctccttctactcctcctttaagacagaacagctgataaccctgtgggtcctgttt
gtcgtcactattgtgggaaactctgttgtgctgttctccacgtgcagaagaaaaagaaag
tccagaatgaccttctttgtgacacaattggccatcacagactccttcacgggcctgatc
aacatcttgacagacattatttggcgattcacaggagacttcatggcccctgacctggtt
tgcagagtcgtccgctacttgcaggttgtcctgctgtatgcctctacctacgtcctggtg
tccctcagcatagacagataccatgccatcgtttaccccatgaagtttcttcaaggagag
aagcaagccaaagtcctcatcggaatagcgtggagcctctcgttcctgttctccattccc
acgctgatcatatttgggaaaaggacactttccaatggtgaggtgcagtgctgggcactg
tggccggatgactcctactggaccccgtacatgaccatcgtcgcctttctggtgtacttc
attcccttggcaattatcagcgttatctatggccttgtgatccgaactatttggatgaaa
agcaaaacccatgagacggtgatttccaactgctcagatggcaaactatgctgcagctac
aaccgagggctcatctctaaggcaaaaatcaaggccatcaagtatagcatcgtcataatc
cttgctttcatctgctgctggagcccatacttcctctttgacatattagacaacttcaac
gtccttccagacaccaaggagcgtttctatgcctctgtgattatccagaacctgcccgcc
ttgaacagtgccattaaccccctcatctactgcatcttcagcagctccatctgctccccc
tgcaagatgcaaagatcacaggattccagaatgacataccgagagagaagcgagagacac
gagatgcagattctctccaagccggaattcatctaa

DBGET integrated database retrieval system