KEGG   Mus musculus (mouse): 319387Help
Entry
319387            CDS       T01002                                 

Gene name
Adgrl3, 5430402I23Rik, CIRL-3, D130075K09Rik, Gm1379, LEC3, Lphn3, mKIAA0768
Definition
(RefSeq) adhesion G protein-coupled receptor L3
  KO
K04594  
latrophilin 3
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Other
   Latrophilin
    319387 (Adgrl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5; 5 D-E1
AA seq 1528 aa AA seqDB search
MWPPQLLILTMLLAPVVHGGKHNERHPALAAPLRHAERSPGGALPPRHLLQQPAAERSTA
HRGQGPRGAARGVRGPGAPGAQIAAQAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIM
IESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPG
TYKYLEVQYECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYM
PWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFD
LRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNP
YTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSL
VDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGPVHHGQVSYISPP
IHLDSELERPPVRGISTTGSLGMGSTTTSTTLRTTTWNIGRSTTASLPGRRNRSTSTPSP
AVEVLDDVTTHLPSAASQIPAMEESCEAVEAREIMWFKTRQGQVAKQPCPAGTIGVSTYL
CLAPDGIWDPQGPDLSNCSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSV
RAMDQLVGLLDVQLRNLTPGGKDSAARSLNKLQKRERSCRAYVQAMVETVNNLLQPQALN
AWRDLTTSDQLRAATMLLDTVEESAFVLADNLLKTDIVRENTDNIQLEVARLSTEGNLED
LKFPENMGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEAMSTN
HSVIVNSPVITAAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYW
STQGCRLLTTNKTHTTCSCNHLTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCL
LICIFTFCFFRGLQSDRNTIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFL
AAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVC
WLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNIKSWVIGAIA
LLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTH
CCSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASL
NREGLLNNARDTSVMDTLPLNGNHGNSYSIAGGEYLSNCVQIIDRGYNHNETALEKKILK
ELTSNYIPSYLNNHERSSEQNRNMMNKLVNNLGSGSEDDAIVLDDAASFNHEESLGLELI
HEESDAPLLPPRVYSTDNHQPHHYSRRRFPQDHSESFFPLLTDEHTEDLQSPHRDSLYTS
MPALAGVPAADSVTTSTQTEAAAAKGGDAEDVYYKSMPNLGSRNHVHPLHAYYQLGRGSS
DGFIVPPNKDGASPEGTSKGPAHLVTSL
NT seq 4587 nt NT seq  +upstreamnt  +downstreamnt
atgtggccaccacagctactcatcctcacgatgcttttagcacctgtagttcatggtggc
aagcacaatgagagacatccagccctcgctgctccactgcgacacgctgagcgcagccca
ggaggcgctctccctcccagacatctccttcagcagccagcggcagagcgctcaacggct
catcgaggacaggggccacgcggagctgccagaggagtccgtggaccaggtgccccagga
gcacagattgcagcccaagctttcagccgcgccccaattcccatggcagtggtccgcaga
gagctctcctgtgagagctaccccattgagctccgttgtccgggcacagacgtcatcatg
atcgagagcgccaactacgggaggaccgatgacaagatctgtgactcggaccctgctcag
atggagaacattcggtgttatctgccagatgcctataagattatgtctcaaagatgcaat
aacagaacccagtgtgcagtggtggcaggtcctgatgtatttccagacccatgtccggga
acatataaataccttgaagtgcagtatgaatgtgtcccttataaagtggaacaaaaagtt
tttctttgtcctggactgctaaaaggagtgtaccagagtgaacacttgtttgaatctgac
caccaatctggggcatggtgcaaggaccctctacaggcttctgacaagatttactatatg
ccctggactccctacagaactgacaccctgacagagtattcgtccaaagatgacttcatt
gctggaaggccaacaactacctacaagctccctcacagagtggatggcactggatttgta
gtatacgatggtgccctcttcttcaacaaggagcggacaaggaacattgtaaagtttgat
ttgaggactaggataaagagtggagaggcaatcatagcaaatgctaattaccatgacacc
tccccataccgatggggtggcaagtccgacatagacttggcagtggatgaaaatggatta
tgggtaatctatgcaacagaacagaacaatggcaagattgtcattagccagttgaaccct
tacaccctacggattgaggggacatgggacactgcctatgataaaaggtcagcttccaat
gcattcatgatttgtgggattctgtatgtggtcaaatctgtatatgaggatgatgacaac
gaggccaccggtaataagattgactacatttacaacactgaccaaagcaaggatagcttg
gtggatgtaccctttcccaactcttaccagtacatagcagctgtggattacaatcccagg
gacaatctgctctatgtgtggaataactaccacgttgtgaaatactctttggacttcggg
cctctggatagtagatcagggccggtacatcatggacaagtctcctacatctctccacca
attcacctcgactctgaactagaaaggccccctgtcagagggatttctaccacaggatcc
ctgggtatgggaagcacgaccaccagcaccaccctccggaccacaacctggaacataggc
aggagtaccaccgcatccttgccgggcagaagaaaccgcagtaccagcacgccatccccc
gcggtagaggtgctggatgacgtcaccacacacctgccctcggcagcctcccaaatccca
gctatggaagagagctgcgaggctgtggaagcccgagaaatcatgtggtttaagaccaga
caggggcaggtagcaaagcagccatgcccagcaggaaccataggtgtatcaacttaccta
tgtcttgctcctgatggaatatgggacccccaaggaccagatctcagcaactgctcttct
ccttgggtcaatcacataacacagaagctgaaatccggagaaacagctgccaatattgcc
agagagctagcagaacagacaagaaatcacttgaacgctggggacatcacctactctgtc
cgtgccatggaccagctggttggcctcttggatgtccagctcaggaatttgacaccaggg
ggaaaagacagcgcagcccgcagcttgaacaagcttcagaaaagagagcgctcttgcaga
gcctatgtccaggcgatggtggagacagttaacaacctccttcagccacaagctttgaat
gcctggagagacctgacgacaagtgatcaactgcgtgcggccaccatgttgcttgacact
gtggaggagagcgctttcgtgttagctgataaccttttgaagaccgacattgtcagggag
aatacagacaatattcagttagaagttgcaagactgagcacggaaggaaacctagaagat
ctaaaattcccagagaacatgggccacggaagtaccatccagctctcagcaaacacatta
aagcaaaatggccggaatggagagattagagtggcttttgtcctgtataataacctgggt
ccttatttgtctacggagaatgccagtatgaagttgggcacagaagctatgtccacaaat
cactcggttatcgtcaattcccctgttattacagcagcaataaataaggaattcagtaat
aaagtgtatttggctgatcctgtggtatttactgttaaacacatcaagcagtcagaagaa
aatttcaaccctaactgttcattttggagctattccaagcgcacaatgacaggttattgg
tcaacacaaggctgtcgactcctgacaaccaacaagacacatactacatgctcctgtaac
cacctcaccaactttgcagtattgatggcacatgtggaagttaagcacagcgatgcagtc
cacgatcttcttctggatgtgatcacgtgggttggcatcttgctgtcccttgtctgtctc
ctgatttgcatcttcacattctgcttcttccggggactccagagtgaccgcaacaccatt
cacaagaacctctgcatcagcctgttcgtggcagaactgctcttcctgattggaatcaac
agaaccgaccaaccaattgcctgtgcagtgttcgcggctcttttgcatttcttcttcttg
gcggccttcacctggatgtttctagaaggggtgcagctgtatatcatgctggtggaggtc
tttgagagcgagcattcccgtaggaagtacttttatctggtcggctatgggatgcccgcg
ctcatcgtggccgtttctgcggccgtcgactacaggagctacggaacagacaaagtatgt
tggcttcgccttgacacctacttcatttggagttttataggaccggcgaccttgataatt
atgctgaatgtcatcttccttgggattgctttatacaaaatgtttcaccatactgccata
ctgaaacctgaatcaggctgtcttgacaatatcaagtcatgggttataggtgcaatagct
ctgctctgcctgttaggattgacctgggcctttggactcatgtatattaatgaaagcaca
gtcatcatggcgtatctcttcaccattttcaattctctacagggaatgtttatattcatt
ttccactgtgttctacagaagaaggtacggaaagagtatgggaaatgcctccgcacgcat
tgctgtagtgggaaaagcacggagagttcgattggctcagggaaaacatctggttctcga
actccaggacggtactccacaggctcgcagagccggattcggagaatgtggaatgacact
gtccgaaagcagtcagagtcgtccttcatcaccggagacataaacagctcagcatcgctc
aacagagaggggcttctgaacaatgccagggatacaagtgtcatggatactctaccactg
aatggtaaccatggcaacagttacagcattgctggcggcgaatacctgagcaactgtgtg
caaattatagaccgtggctataaccacaacgagaccgccctagagaaaaagatcctaaag
gaactcacttccaactatatcccttcatacctgaacaaccacgagcgctccagcgaacag
aaccggaatatgatgaacaaactggtgaacaacttaggcagcgggagtgaagatgacgcc
atcgtcctggatgacgccgcgtcctttaaccacgaggagagtctgggcctggaactcatt
cacgaggaatccgatgctcccttgctgcccccgagggtttactccacggataaccaccag
ccacaccattacagcaggaggcggttcccccaggaccacagcgagagcttcttccctctg
ctaaccgacgagcacacagaagacctgcagtcaccgcacagggactctctgtacaccagc
atgccagccctggccggcgtgcccgctgcagacagtgtgaccaccagcacccagaccgaa
gccgcagcggccaagggtggtgacgccgaagatgtttactacaaaagcatgccaaacctg
ggctccagaaaccacgtgcacccgctgcacgcctactaccagctggggcgcggcagcagc
gacggattcatagttcctcctaacaaagatggggcctctccggaggggacttccaaagga
cccgcgcacttggtcactagtctatag

DBGET integrated database retrieval system