KEGG   Mus musculus (mouse): 319520Help
Entry
319520            CDS       T01002                                 

Gene name
Dusp4, 2700078F24Rik, AI844617, BB104621, E130306H24Rik, MKP2
Definition
(RefSeq) dual specificity phosphatase 4 (EC:3.1.3.16 3.1.3.48)
  KO
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    319520 (Dusp4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     319520 (Dusp4)
    3.1.3.48  protein-tyrosine-phosphatase
     319520 (Dusp4)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    319520 (Dusp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8; 8 A4
AA seq 398 aa AA seqDB search
MVTMEELREMDCSVLKRLMNRDENGGGGSAGGNGSGSHGALGLLSGGKCLLLDCRPFLAH
SAGYIRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAE
SLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSTN
ESLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHF
EGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLM
MKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTTSCAAEAASPSGPLRERGKA
TPTPTSQFVFSFPVSVGVHAAPSNLPYLHSPITTSPSC
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgatggaggaactgcgggagatggactgcagcgtgctcaaaaggctgatgaac
cgggatgagaacggcggcggcggcagcgcgggcggcaacggcagcggcagccacggcgcc
ttggggctgctgagcggcggcaagtgcctgctgctggactgcaggccgtttctggctcac
agcgcgggctacatccgaggctcggtgaacgtgcgctgcaataccatcgtgcggcggagg
gccaagggctccgtgagcctggagcagatcctgcccgccgaggaagaggtgcgtgcccgc
ctgcgctctggcctctactcggctgtcatcgtctacgacgagcgcagcccgcgcgccgag
agtctccgggaggacagcacggtgtcgctggtcgtgcaggcgttgcgccggaacgcggag
cgcacggacatctgcctgcttaaaggtggctatgagaggttttcttctgaatacccagaa
ttctgctctaaaaccaaggccctggccgccatcccaccccctgtacctcccagcaccaat
gagtccttggacctgggctgcagctcctgtggaaccccgctgcacgaccaggggggcccc
gtggaaatcctccctttcctctacctcggcagtgcctaccatgctgcccgcagggacatg
ttggatgccctggggatcacggccctcctgaatgtctcttcagactgtcccaatcacttt
gagggtcattaccagtacaagtgcatccccgtcgaagacaaccacaaggccgacatcagc
tcctggttcatggaagccatcgagtacatcgacgcagtaaaggactgtcgagggcgagtg
ctggttcactgccaggccggcatctcccgatcagccaccatctgcctggcctacctgatg
atgaagaagcgggtgaggctggaggaggcttttgagttcgtcaagcagcgccgaagcatc
atctcgcccaacttcagcttcatgggccagttgctgcagtttgagtctcaggtgctcacc
acgtcctgcgccgccgaggctgccagcccttctgggccccttcgggagaggggaaaggcc
accccgacccccacctcgcagttcgtcttcagcttccctgtgtctgtgggcgtgcacgcg
gcccccagtaacctgccgtacctgcacagccccatcaccacctcccccagctgttag

DBGET integrated database retrieval system