KEGG   Mus musculus (mouse): 319554Help
Entry
319554            CDS       T01002                                 

Gene name
Idi1, 4832416K17Rik
Definition
(RefSeq) isopentenyl-diphosphate delta isomerase (EC:5.3.3.2)
  KO
K01823  
isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Module
C5 isoprenoid biosynthesis, mevalonate pathway
C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    319554 (Idi1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     319554 (Idi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13; 13 A1
AA seq 283 aa AA seqDB search
MWRGRTLARAIGYAVRGRGLEAEHAAERIEVQLSAQLLSTCSRNLCVLGQIRHSVTMPEI
NTSHLDEKQVQLLAEMCILIDENDNKIGADTKKNCHLNENIDKGLLHRAFSVFLFNTENK
LLLQQRSDAKITFPGCFTNSCCSHPLSNPGELEENNAIGVKRAAKRRLKAELGIPLEEVD
LNEMDYLTRIYYKAQSDGIWGEHEVDYILFLRKNVTLNPDPNEIKSYCYVSKEEVREILK
KAASGEIKLTPWFKIIADTFLFKWWDNLNHLSPFVDHEKIHRL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcggacggacactggcgcgagcgattggatatgctgttagagggcggggcctg
gaggcggagcatgctgcggagaggattgaagtacagctctccgcacagcttctcagcacc
tgcagccggaatctctgtgttctaggtcagatcagacattctgtcacaatgcctgaaata
aataccagccatcttgatgaaaaacaggttcagcttctagcggagatgtgtattcttatt
gatgaaaatgacaataaaattggggctgacaccaagaaaaactgtcaccttaatgaaaac
atcgacaaaggattattacatcgagcttttagtgtcttcttgtttaatactgaaaataag
ctcctgttacagcagagatcagatgctaaaattacctttccaggttgtttcaccaatagt
tgctgtagtcatccattaagtaacccaggcgagctggaagagaacaacgccattggtgtg
aagcgagcagcaaagcggcgcttgaaagccgagttgggaatacccttggaagaggttgat
ctaaatgaaatggattatctaacaagaatttactacaaggcccaatctgatggtatctgg
ggtgaacatgaagttgattacattctgtttctgaggaagaatgtaaccttgaatccagat
cccaacgagattaaaagctattgctatgtatcaaaggaagaagtcagagaaattttgaag
aaggcagccagtggtgaaattaagttaactccgtggtttaagataattgcagatactttc
ctcttcaaatggtgggataacttaaaccatttgagtccatttgttgaccatgagaaaata
catagattgtga

DBGET integrated database retrieval system