KEGG   Mus musculus (mouse): 319625Help
Entry
319625            CDS       T01002                                 

Gene name
Galm, A530057M15Rik, AU015645, AU020959
Definition
galactose mutarotase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmu00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 E3; 17
AA seq 342 aa AA seqDB search
MVSVTRTVFGELPSGGGTVEKFQLRSDQLSVDIISWGCTITALQVKDRQGKASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGRFTIGGKEYHLPVNREPNSLHGGFTGFDKVLWTP
QVLTNGVQFFRVSPDGEEGYPGELKVWVTYTLDGGELVINYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGTHLQDYHIH
GFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggtgaccagaaccgtgtttggagagctgccctcggggggagggacagtggag
aaattccagcttcggtcagaccagctgagtgtggacatcatctcatggggctgcacgatc
actgctctgcaggtcaaagacaggcaggggaaagcctcagacgtggtgcttggctttgcg
gaattggaaggttacctccagaagcagccctactttggagcagtggttgggagggtagcc
aaccgaattgccaaaggaagattcactataggtgggaaggagtaccacctgccagttaac
agagagcccaacagtctccatggcggattcacggggtttgataaggtcctctggacccct
caggtgttgaccaatggcgtccagttctttcgagtcagtccagatggtgaggaaggctac
cctggagagctgaaagtctgggtgacatataccctggatggtggggagcttgtaatcaac
tacagagcacaggccagccagaccactccagttaatctgaccaaccattcttatttcaac
ctagcaggccagggctccccaaatatatatgaccatgaagtcaccattgcagcagatgca
tatttgcccgtggatgaaactctgattccaacaggagtcattgctccagtggaaggaact
gccttcgacctgagaaagccagtggagcttggaacacacctgcaggattaccacatccat
ggtttcgaccataatttctgtctgaaggagtcaaaagaaaagaagttttgtgcaagggtg
cgtcacgctgcaagtgggaggatcctggaagtatataccacacaaccaggcgtccagttt
tacacaggaaacttcttggatggtactctgaaaggcaagaacggtgcggtgtatcccaag
cactcaggtctctgcctcgagacccagaactggcctgattcggtcaatcagccccagttc
cctccggcgctgctgaggcctggagaggaatacaaccacactacctggttcaagttctct
gttgcttaa

DBGET integrated database retrieval system