KEGG   Mus musculus (mouse): 319625Help
Entry
319625            CDS       T01002                                 

Gene name
Galm, A530057M15Rik, AU015645, AU020959
Definition
galactose mutarotase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    319625 (Galm)
   00052 Galactose metabolism
    319625 (Galm)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     319625 (Galm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 E3; 17
AA seq 342 aa AA seqDB search
MVSVTRTVFGELPSGGGTVEKFQLRSDQLSVDIISWGCTITALQVKDRQGKASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGRFTIGGKEYHLPVNREPNSLHGGFTGFDKVLWTP
QVLTNGVQFFRVSPDGEEGYPGELKVWVTYTLDGGELVINYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGTHLQDYHIH
GFDHNFCLKESKEKKFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggtgaccagaaccgtgtttggagagctgccctcggggggagggacagtggag
aaattccagcttcggtcagaccagctgagtgtggacatcatctcatggggctgcacgatc
actgctctgcaggtcaaagacaggcaggggaaagcctcagacgtggtgcttggctttgcg
gaattggaaggttacctccagaagcagccctactttggagcagtggttgggagggtagcc
aaccgaattgccaaaggaagattcactataggtgggaaggagtaccacctgccagttaac
agagagcccaacagtctccatggcggattcacggggtttgataaggtcctctggacccct
caggtgttgaccaatggcgtccagttctttcgagtcagtccagatggtgaggaaggctac
cctggagagctgaaagtctgggtgacatataccctggatggtggggagcttgtaatcaac
tacagagcacaggccagccagaccactccagttaatctgaccaaccattcttatttcaac
ctagcaggccagggctccccaaatatatatgaccatgaagtcaccattgcagcagatgca
tatttgcccgtggatgaaactctgattccaacaggagtcattgctccagtggaaggaact
gccttcgacctgagaaagccagtggagcttggaacacacctgcaggattaccacatccat
ggtttcgaccataatttctgtctgaaggagtcaaaagaaaagaagttttgtgcaagggtg
cgtcacgctgcaagtgggaggatcctggaagtatataccacacaaccaggcgtccagttt
tacacaggaaacttcttggatggtactctgaaaggcaagaacggtgcggtgtatcccaag
cactcaggtctctgcctcgagacccagaactggcctgattcggtcaatcagccccagttc
cctccggcgctgctgaggcctggagaggaatacaaccacactacctggttcaagttctct
gttgcttaa

DBGET integrated database retrieval system