KEGG   Mus musculus (mouse): 319713Help
Entry
319713            CDS       T01002                                 

Gene name
Ablim3, AW990719, D930036B08Rik
Definition
(RefSeq) actin binding LIM protein family, member 3
  KO
K07520  
actin-binding LIM protein
Organism
mmu  Mus musculus (mouse)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04360 Axon guidance
    319713 (Ablim3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18; 18 E1
AA seq 682 aa AA seqDB search
MNTSIPYQQSPYSPRGGSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMTSSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CSVILTGEYISKDGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHYYRSGPESGRSSPYHSQLDVRSST
PTSYQAPKHFHIPAGESNIYRKPPIYKRHGDLSTATKSKTSEDISQASKYSPAYSPDPYY
ASESEYWTYHGSPKVPRARRFSSGGEEEDFDRSMHKLQSGIGRLILKEEMKARSSSYADP
WTPPRSSTSSREALHTTGYEMSFNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSAD
LFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGMT
ISEFERLALWKRNELKKQARLF
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgagcattccttaccagcagagtccgtacagtccccggggcggctccaatgtc
atccagtgctaccgctgcggagacacctgcaaaggggaggtggtccgtgtccacaacaac
cacttccacatccgatgcttcacttgtcaagtatgtggatgtggcctggcccagtcgggc
ttcttcttcaagaaccaggagtacatctgcacccaggactaccaacagctttatggcacc
cgctgtgatagctgccgggacttcatcacgggtgaggtcatctctgccctgggccgtacc
taccaccctaaatgcttcgtatgcagcttgtgcaggaagcctttccctattggagataag
gtgaccttcagtgggaaagaatgtgtatgtcagacgtgctcccagtcaatgaccagcagc
aagccgatcaagatccgtggaccaagccactgtgctgggtgcaaagaggagattaaacat
ggccagtcacttctggcactggacaagcagtggcacgtcagctgtttcaaatgccagacc
tgtagcgtcatcctcactggggaatacattagcaaagacggtgttccatactgcgagtct
gactaccactcccagtttggcatcaaatgtgagacttgtgaccggtacatcagtggcagg
gtcttggaggcaggagggaaacactaccaccctacctgtgccagatgtgtacgctgccac
cagatgttcactgagggggaggagatgtatctcacaggttctgaggtttggcacccaatc
tgcaagcaggcagccagggcagagaagaagctcaagcacaggcggacatctgaaacttcc
atctcaccccctggttccagcatcgggtcgcctaaccgagtcatctgtgctaaagtggat
aatgagatccttaattacaaagacctggcagctctccccaaggttaagtccatctacgag
gtgcaacgccccgacctcatttcctacgagcctcattccagatacacctccgacgagatg
ctggagagatgcggttatggagagtcactgggaacattatctccttactcccaggacatc
tatgagaacctggacctccggcagaggcgggcctccagccctggctacattgattccccc
acctacagtcggcaaggcatgtctcccaccttctcccgctcgcctcattactaccgctca
gggcctgagagtggccggagctccccataccatagccaattagatgtgaggtcctccacg
ccaacctcttaccaggctcccaagcactttcacatcccagctggagagagtaacatctac
cgaaaacccccgatctacaaacggcatggtgatttgtccacagcaaccaagagcaaaaca
agtgaagacatcagccaggcctccaagtatagcccagcctactcgccagacccctactat
gcttcagagtctgagtattggacctaccatgggtcccccaaagtgccccgagccagaagg
ttctcatctggaggagaggaagaggattttgaccgaagcatgcacaagctccagagtggg
attggccggctgatcctgaaggaagagatgaaggcgcggtcaagctcctatgcggatcct
tggacccctccacggagctccaccagcagtcgggaggccctgcacaccactggctatgag
atgtccttcaatggctcccctcgttcacactacctggctgacagtgatcccctcatctcc
aaatctgcctcactgcctgcctacaggagaaatgggctgcacaggacacccagtgcggac
ctcttccactacgacagcatgaacgcagtcaactggggcatgcgagagtacaagatctat
ccttatgagctgctactggtgaccacaagaggaaggaaccgactgccaaaggatgtggac
cggactcgcttagagcgccacctgtcccaggaggagttctaccaagtcttcggcatgacc
atctccgagttcgagaggctagccctctggaagaggaacgaactgaagaagcaagcccgg
cttttctag

DBGET integrated database retrieval system