KEGG   Mus musculus (mouse): 320119Help
Entry
320119            CDS       T01002                                 

Gene name
Rps6kc1, AA682037, B130003F20Rik, C80612, Rpk118
Definition
(RefSeq) ribosomal protein S6 kinase polypeptide 1 (EC:2.7.11.1)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 H6
AA seq 1056 aa AA seqDB search
MTSPWGHSADLARFYTVTEPQRHPRGYTVYKVTARVVSRRNPEDVQEIIVWRRYSDFKKL
HRELWQIHRNAFRHSELFPPFAKGTVFGRFDKTVIEERRQCAEDLLQFSANIPALYNSRQ
LQDFFKGGVISDGSELIGPAEAYPDSPANAFPECGTEGFSSDSDLLSLTVDADSLAEVDD
GMASRQGSPSRTFGLSLSTDSSAVGAVASDSEPSRVEDRESRSLFPSSLKPRLGRRDYLE
KAGELIKLALKKEEEDDYEAASDFYRKGVDLLLEGVQGESSPTRREAVKRRTAEYLMRAE
SICSLRAAPQLHTGPQPPGSLSSRPPWSLRSPAEELKAFRVLGVIDKVLLVMDTRTEQTF
ILKGLRKSSECSRNRKTIIPRCVPNMVCLHTYIISEESVFLVLQRAEGGKLWSYISKFLN
RSSQESLDIKEGRPSMPPRVCLQQPSASPQGGSSFESRGSDTGSMLKALPLKTSLTPSSQ
DDSNQEDDGQPSSPKWLDSGSSSEDECTAGYLTLCNEYGQEKMDLVSLSEESVMQPEGDK
ADTQAVSSPASLATGSVSPSTHLRVFSGGEDLEAVSSPPTSESLSRSKNSPMEFFRIDSK
DSTSELLGLDFGEKLHSLKPEPLKALFTLEDGDSPSQSLDPGESKRESEAQDSVSRGSDD
SVPVISFKEAAAEAISGAEEGRPDLLVNLPGELQPTKEASAMDPKFSQASAGRLDSKLLE
APDVLCLRLSSEQCHGLGPEGPEELSDPTEFCPGGVIPEHDAQADPGVLFEAAVDHRSSP
DQFLFSSLRSESDRLGQVEVVVTAQALQESLFHISSPCSGANKEHSAYADTATSEEVLLF
TEPTKEEANSLFQRDSEAQERGVGAGEADKEIHQIFEDLDKRLAASSRFFIPEGCIQRWA
AEMVVALDALHREGIVCRDLNPNNILLNDGGHIQLTYFSRWSEVEDSCDSDAVARMYCAP
EVGAVTEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPGCVSEEARSLIQQ
LLQFNPMERLGAGVAGVEDIKSHPFFTPVDWAELTR
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgacctctccttggggtcacagtgcggacctggcccgcttctacactgtcaccgagccc
cagcgacaccccaggggctacactgtctataaggttaccgcacgggttgtttcacggaga
aatccagaggacgtccaggagataattgtgtggaggagatacagtgacttcaagaaactg
cacagagaattatggcaaattcacaggaatgcatttcgacactctgagctatttcccccg
tttgctaaagggacagtgtttgggcggttcgacaagacggtgattgaggagcgacggcag
tgtgctgaggacctgctgcagttctctgccaacatccccgccctgtacaacagcaggcag
ctccaggacttcttcaagggtggggtaattagtgatggctctgagttaattggccctgct
gaagcttacccagactccccggccaacgcctttcctgagtgcggtactgaaggattctcc
agtgacagtgaccttctgtccctcactgttgatgcagactctcttgccgaggtagatgat
ggaatggcttcccgtcagggttctcccagtagaacctttggtctgagtctgtctacggat
tcttcggcagtaggggctgttgcttctgacagtgaaccaagcagagtagaagaccgggaa
agccgcagcctcttccccagcagcttaaagccaaggcttggcaggagagattacctggag
aaggcaggggaacttatcaaactggccttaaagaaggaggaggaagatgactatgaagct
gcttctgacttttacaggaagggcgtcgatctgctcctagaaggtgtacaaggagagtcg
agccccacgcgtcgggaggctgtgaagagaaggactgcggagtacctcatgcgtgcagag
agcatctgtagcctccgggccgcgcctcagctccacacgggaccacagcctccaggatca
ctaagttcaaggcccccttggagcctgaggagccctgccgaggagctgaaggccttccga
gtccttggggtgattgacaaggttttacttgtaatggatacaaggacagagcagacattc
attttaaaaggtctaaggaaaagcagcgagtgcagcaggaacagaaagaccatcatcccc
cgctgtgtgcctaacatggtgtgtctgcacacgtacatcatctcggaggaatcggtgttt
ctcgtgctgcagcgcgccgaaggtggaaaactctggtcgtatatcagtaaatttctgaac
agaagctctcaggaaagcttggacattaaggaagggagaccgtccatgcctcctcgagtg
tgcctgcagcagccaagtgccagtccccagggcggcagcagcttcgagtccagagggagc
gacacggggagcatgctgaaggctctgcctctgaagaccagtctcaccccgagttctcaa
gacgacagcaaccaggaagacgacggccagcccagctctcccaagtggctggattcgggc
tccagttcagaggatgagtgcacagcgggctacctgacgctgtgcaacgagtatgggcaa
gaaaagatggacctggtgtctctgagcgaggagtctgttatgcagcctgaaggggacaag
gctgacacccaggcggttagttccccagcatccctcgccactggcagtgtgagccctagc
acccacctcagggtcttctctggaggtgaggatctagaggcggtttcttctcctccaaca
tctgaatccctcagtaggtcaaaaaacagccctatggaattcttcagaatagacagtaaa
gacagcacaagtgagctcctgggactggattttggtgagaaattacacagtctgaaacca
gagcctttgaaagccctctttacccttgaagatggagacagcccttctcagagtcttgat
cctggtgagagcaagagagagagtgaagctcaggactccgtgagccggggctcagatgat
tccgtcccagttatctcatttaaagaggcggctgcagaggctatcagtggggctgaggag
ggaaggcctgaccttcttgtgaatttacctggggaactgcagccaaccaaagaggcttca
gcaatggaccctaagttttcacaggccagtgcaggcaggctggatagtaaactgctggaa
gccccggatgtgttgtgcctcaggctgagttctgaacagtgccatggtctgggaccagaa
ggcccagaggaactgagcgatcccactgaattctgtcccggaggtgtgatcccagagcac
gatgctcaggcagatcccggggtgctattcgaggctgccgttgatcacaggagctcccca
gaccagtttctgttttccagcttgcgttccgagtctgacaggctggggcaggtggaggta
gtggtcactgcacaggccttgcaagaaagcctgttccacatttctagtccctgctcaggt
gctaataaagaacacagtgcatacgccgacactgccacgtcggaggaggtgttgctgttc
acagaaccgactaaagaagaagcgaactctctgttccagagagactcggaggcccaggag
cgaggtgtgggagccggggaagcagacaaggaaatccatcagatctttgaggacctggat
aaacgactagcagctagctccaggttcttcatcccagagggctgcattcagagatgggca
gcggaaatggtggtagcccttgacgccttgcacagagaggggattgtgtgccgagatctg
aacccaaacaacatcttattgaatgatggaggacacattcagctaacgtattttagcagg
tggagtgaggttgaagattcctgcgacagcgatgccgtagcgagaatgtactgtgcccca
gaggttggagcagtcacagaagaaactgaagcctgtgattggtggagcctgggtgctgtc
ctcttcgaacttctcactggcaagacgttggtggaatgccacccagccggaataaatacc
cacactactttgaacatgccaggttgtgtttctgaagaggctcgctcactcatccaacag
ctcctgcagttcaaccctatggagcgcctgggtgctggagtggctggtgttgaagatatc
aaatctcacccgtttttcacccctgtggattgggcagagttgacaagatga

DBGET integrated database retrieval system