KEGG   Mus musculus (mouse): 320139Help
Entry
320139            CDS       T01002                                 

Gene name
Ptpn7, BPTP-4, C920001D21Rik, HEPTP, LC-PTP, LPTP
Definition
protein tyrosine phosphatase, non-receptor type 7 (EC:3.1.3.48)
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    320139 (Ptpn7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     320139 (Ptpn7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 E4; 1
AA seq 359 aa AA seqDB search
MVQACEGRSRAQLPTLSLGADMTQPPPTKAPAKKHVRLQERRGSSVALMLDVQSLGTVEP
ICSVNTPREVTLHFLRTAGHPLTRWTLQHQPPSPKQLEEEFLKIPSNFVNPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDSDYINANYIRGYDGKEKVYIATQGPMPNTVADFW
EMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQIRIQDMKEHPEYTVRQLTIQH
QQECRSVKHILFSAWPDHQTPESAGPLLRLVAEVETPETAANSGPIVVHCSAGIGRTGCF
IATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAAQLPPEPNP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtccaggcctgtgaggggcgctccagagcacagctgccgaccttgtctttgggggca
gacatgactcagcctccacccaccaaagctccagccaagaagcatgtgcggctgcaggag
agaaggggctccagtgtggctctgatgctggatgtacagtctctgggcacggttgaaccc
atctgctcagtgaacacaccccgggaagtcaccctacacttcctgcgcacggctggacac
ccccttacacgctggacgctacagcaccaacctcccagccccaagcagctagaggaggaa
ttcttgaagattccctcaaactttgtcaaccctgaagacctggatatccctggccacgcc
tccaaagaccgctacaagaccatcttgccaaatccccagagccgtgtctgtcttggccgg
gcacagagccaggaggacagtgactacatcaatgccaactacatccggggctatgacggg
aaggagaaggtctacattgccacccagggccccatgcccaacactgtagcagacttctgg
gagatggtgtggcaagaagacgtatccctcattgtcatgctcacccagctccgagagggc
aaggagaaatgtgtacactactggcccacagaagaggaagcctatgggcccttccagatc
cgcatccaggacatgaaagagcacccagaatacactgtgaggcaactcaccatccagcac
caacaggaatgccgttcagtgaagcacatcctcttctcagcctggccagaccaccagact
ccagaatcagcggggcccctgctgcgcctggtggccgaggtggagactccagagacagct
gccaactccgggcctatagtggttcactgcagtgcagggatcggccggaccggctgcttc
atcgccacccgcatcggctgccagcagctgaaggcccgaggggaggtggatattctgggc
atcgtgtgccaacttcgactagacagaggaggcatgatccagacggccgagcagtaccag
tttctgcaccacactttggccctatatgcagcccagctgcccccggagcccaacccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system