KEGG   Mus musculus (mouse): 320635Help
Entry
320635            CDS       T01002                                 

Gene name
Cyb5r2, D630003K02Rik, b5R.2
Definition
(RefSeq) cytochrome b5 reductase 2
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    320635 (Cyb5r2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     320635 (Cyb5r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 320635
NCBI-ProteinID: NP_796190
MGI: 2444415
Ensembl: ENSMUSG00000048065
Vega: OTTMUSG00000059945
UniProt: Q3KNK3
Position
7; 7 E3
AA seq 276 aa AA seqDB search
MSVKKKDLITLQDPEAKYPLPLIEKEQISHNTRRFRFGLPSPDHVLGLPVGNYVHLLAQI
NNELVIRAYTPVSSDDDQGFVDLIIKIYFKNVHPKYPEGGKMTQYLENMKIGDTILFRGP
TGRLFYNEPGTLLIKANKTSEPEKKLVHHLGMIAGGTGITPMLQLIRHITKDTSDETRMS
LLFANQTEEDILLRKELEEVATTHHKQFNLWYTLDRPPSDWKYSSGFVSADMIKEHLPPP
GEDTLILVCGPPPLIQAAAHPSLEQLSYTKDMIFIY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcaagaagaaagatcttatcaccttacaggaccctgaagccaagtacccgctg
cccttgattgagaaggagcaaatcagtcacaacaccagaaggttccgctttgggctgccc
tcaccagaccatgtcctggggcttcctgtcggtaactatgtccatctcttggcacaaatt
aacaatgaattggtgatcagggcttacacacctgtctccagtgacgatgatcaaggcttt
gtggacttaattataaagatctacttcaaaaatgtgcaccccaagtatcctgaaggagga
aagatgactcagtacttggagaacatgaaaattggggataccatcctttttcgggggcca
acagggcgcctgttctacaatgagccaggaacccttttaatcaaagcaaacaaaacaagt
gagcctgaaaaaaagctggttcaccacctggggatgattgctggaggcacaggcattacg
cccatgctacagctgattcgccacatcaccaaggacaccagcgatgagaccaggatgtcc
ctcctctttgctaaccagacagaagaggatatcttgctgagaaaggagctagaagaagtc
gccacgactcatcacaaacagttcaacctgtggtataccctggacaggcctcccagtgac
tggaagtacagctcaggctttgttagcgctgacatgatcaaggagcacctccctcctcct
ggggaggacacgctcatcctggtgtgtggcccaccacctctgatccaggcggcagctcac
cccagcctggagcagctcagctataccaaggacatgatttttatctactaa

DBGET integrated database retrieval system