KEGG   Mus musculus (mouse): 320635Help
Entry
320635            CDS       T01002                                 

Gene name
Cyb5r2, D630003K02Rik, b5R.2
Definition
cytochrome b5 reductase 2 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    320635 (Cyb5r2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     320635 (Cyb5r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 E3; 7
AA seq 292 aa AA seqDB search
MSVKKKDLITLQDPEAKYPLPLIEKEQISHNTRRFRFGLPSPDHVLGLPVGNYVHLLAQI
NNELVIRAYTPVSSDDDQGFVDLIIKIYFKNVHPKYPEGGKMTQYLENMKIGDTILFRGP
TGRLFYNEPGCQTRAAEVKNIFIFLGTLLIKANKTSEPEKKLVHHLGMIAGGTGITPMLQ
LIRHITKDTSDETRMSLLFANQTEEDILLRKELEEVATTHHKQFNLWYTLDRPPSDWKYS
SGFVSADMIKEHLPPPGEDTLILVCGPPPLIQAAAHPSLEQLSYTKDMIFIY
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcaagaagaaagatcttatcaccttacaggaccctgaagccaagtacccgctg
cccttgattgagaaggagcaaatcagtcacaacaccagaaggttccgctttgggctgccc
tcaccagaccatgtcctggggcttcctgtcggtaactatgtccatctcttggcacaaatt
aacaatgaattggtgatcagggcttacacacctgtctccagtgacgatgatcaaggcttt
gtggacttaattataaagatctacttcaaaaatgtgcaccccaagtatcctgaaggagga
aagatgactcagtacttggagaacatgaaaattggggataccatcctttttcgggggcca
acagggcgcctgttctacaatgagccaggctgccagacaagggctgcagaagtcaaaaac
atctttatatttctaggaacccttttaatcaaagcaaacaaaacaagtgagcctgaaaaa
aagctggttcaccacctggggatgattgctggaggcacaggcattacgcccatgctacag
ctgattcgccacatcaccaaggacaccagcgatgagaccaggatgtccctcctctttgct
aaccagacagaagaggatatcttgctgagaaaggagctagaagaagtcgccacgactcat
cacaaacagttcaacctgtggtataccctggacaggcctcccagtgactggaagtacagc
tcaggctttgttagcgctgacatgatcaaggagcacctccctcctcctggggaggacacg
ctcatcctggtgtgtggcccaccacctctgatccaggcggcagctcaccccagcctggag
cagctcagctataccaaggacatgatttttatctactaa

DBGET integrated database retrieval system