KEGG   Mus musculus (mouse): 320795Help
Entry
320795            CDS       T01002                                 

Gene name
Pkn1, DBK, F730027O18Rik, PAK1, PRK1, Pkn, Prkcl1, Stk3
Definition
(RefSeq) protein kinase N1
  KO
K06071  
protein kinase N [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    320795 (Pkn1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    320795 (Pkn1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     320795 (Pkn1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  PKN family
   320795 (Pkn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 C2; 8 40.22 cM
AA seq 946 aa AA seqDB search
MAGDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLKREIRKELKLKEGAENLR
RATTDLGRSLAPVELLLRGSARRLDLLHQQLQELHAHVVLPDPAAGSDATQSLAEGSPIC
SSTNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSSKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQALQAGELESQAAPDEAQGDPELGAVELRIEELRHHFRVEHAVAEGAKNVLR
LLSGAKAPDRKAVSEAQEKLTESNQKLGLLRESLERRLGELPADHPKGRLLREELTAASS
SAFSAILPGPFPATHYSTLSKPAPLTGTLEVRVVGCKNLPETIPWSPPPSVGASGTPESR
TPFLSRPARGLYSRSGSLSGRSSLRGEAENATEVSTVLKLDNTVVGQTAWKPCGPNAWDQ
SFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFR
NPIIERIPRLQRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPSAVATGTFSPNAS
PGAEIRHTGDISMEKLNLGADSDSSSQKSPPGLPSTSCSLSSPTHESTTSPELPSETQET
PGPGLCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDE
VESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPR
AVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFC
GTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPR
FLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLS
GRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFDFVAGGY
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgacgccgtacagagtgagcctcgaagctggtcgctgctggaacagctgggt
ctggctggggctgacctggcagcccccggggtgcagcaacagctggagttagagcgagag
cgactgaagcgggagatacggaaggagctgaagctgaaggagggcgctgagaacctgagg
cgagccaccactgacctgggccgtagcctggcccctgtggagctgctgctgcggggctcc
gctcgacgcctagacttactgcaccagcagctgcaggagctgcatgcacatgtggtgctg
cctgaccctgcagctggaagcgatgctacccaatcccttgcagagggcagccctatctgc
tcatccaccaacctgagcagagtggctgggctggagaagcagctggccattgagctcaag
gtcaaacagggggcagagaacatgatccagacctatagcaatggcagcagcaaggaccgg
aagctgttgttgacagcccagcagatgctgcaggacagtaagaccaagattgacatcatc
cgcatgcagcttcgaagagcgctccaggcactacaggctggagagctggagagtcaggca
gctcctgatgaagcccaaggagatccagaactgggagccgtagagctacgcattgaggag
ctacgacaccattttcgagtggagcatgcagtggcagaaggtgccaagaatgtcctgcgc
ctgctcagtggggcaaaggccccagaccgcaaggcagtcagcgaggctcaggagaaattg
actgagtccaaccagaagctgggcttgctgcgggaatcactggagaggcgccttggggag
ttgcctgccgatcaccccaaggggcggctgcttcgggaggagctcactgcagcctcgtcc
tcagccttcagcgccatactgcctgggcccttccctgccactcactacagcaccttgagc
aagcctgcaccgctcacagggaccctggaagtacgagtggtgggctgcaaaaaccttccc
gagaccatcccctggagccctcccccctcagtgggggcatctgggacccccgaaagccgc
actccgttcctgagtcgccccgctcggggcctttacagccggagtggaagccttagtgga
cggagcagcctcagaggggaggcagagaatgccactgaggtcagcaccgtgctcaagctg
gacaacacagtggtggggcaaacagcctggaagccatgcggccccaatgcctgggaccag
agctttaccctggagctggagagggctcgggagctggagctggctgtgttctggcgagac
cagaggggtctgtgtgctctcaaatttctgaagttggaggacttcttggacaacgagagg
catgaggtgcagctggacatggaaccccagggctgcctggtggctgaggtcactttccga
aaccccatcatcgagcggatccctaggctccaaaggcagaaaaaaatcttctccaagcag
caagggaaggcatttcagcgagccagacagatgaacatagatgtggcgacttgggtgcgg
ctgctccgtagactcatccctagtgctgtggccactggcaccttcagtcccaatgcatct
ccaggtgctgagatccggcacactggagacatatccatggagaaattgaatctcggtgct
gactcagacagctcgtcccaaaagagcccaccagggctgccctccacctcatgcagcctg
agttctccaacccatgaatccaccacatctccagagctgccttcagagacccaggagact
ccaggccctggcctgtgcagccccttgagaaagtcgcccctgacacttgaggacttcaag
ttcctggccgtgcttggccggggtcactttggaaaggtgctgctgtctgaattccgctcc
agtggggagctctttgccatcaaagccttgaagaaaggtgacattgtagcccgagatgag
gttgagagcctgatgtgtgagaagcggattttggcggccgtgaccagggcaggacatccc
ttcctggtgaaccttttcggctgtttccagaccccagagcacgtgtgctttgtgatggag
tactcggcgggtggagacctgatgctgcacattcatagcgacgtgttctcagagcctcgg
gctgtcttctattcggcctgtgtggtgctgggactgcagttcctccatgaacacaagatt
gtctacagggacctgaagttggacaatttgctcctggatactgagggctacgtcaagatc
gcagactttggcctctgcaaggaggggatgggctatggggaccggaccagcacgttctgc
ggaactccggagttcctggcgccggaagtgctcacagacacatcctacacgcgagcagtg
gactggtggggactgggcgtgctgctctatgagatgttggttggagagtctccgttccct
ggggatgatgaggaggaggtatttgacagcattgtcaacgacgaagttcgctatccccgc
ttcctgtctgcagaggccatcggcatcatgagaaggctactgcggaggaacccggagcgg
aggctggggtccactgagcgcgatgcagaagatgtgaaaaaacagcctttcttccggtct
ctgggctgggatgtcctgctggcccgccgcttgcctccacccttcgtgcctacactttca
gggcgcacagatgtcagcaacttcgatgaggagttcactggggaggcccccacactgagt
cctccccgggatgcacggcccctcacagctgcggagcaggcagccttccgggatttcgac
tttgtggccggaggctactag

DBGET integrated database retrieval system