KEGG   Mus musculus (mouse): 320910Help
Entry
320910            CDS       T01002                                 

Gene name
Itgb8, 4832412O06Rik
Definition
(RefSeq) integrin beta 8
  KO
K06591  integrin beta 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    320910 (Itgb8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    320910 (Itgb8)
   04514 Cell adhesion molecules (CAMs)
    320910 (Itgb8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    320910 (Itgb8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    320910 (Itgb8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    320910 (Itgb8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    320910 (Itgb8)
   05414 Dilated cardiomyopathy (DCM)
    320910 (Itgb8)
  Infectious diseases
   05165 Human papillomavirus infection
    320910 (Itgb8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   320910 (Itgb8)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   320910 (Itgb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 320910
NCBI-ProteinID: NP_796264
MGI: 1338035
Ensembl: ENSMUSG00000025321
Vega: OTTMUSG00000026449
UniProt: Q0VBD0
Position
12; 12 F2
AA seq 767 aa AA seqDB search
MCGSALAFLTAALLSLHNCQRGPALVLGAAWVFSLVLGLGQSEHNRCGSANVVSCARCLQ
LGPECGWCVQEDFVSGGSGSERCDTVSSLISKGCPVDSIEYLSVHVVTSSENEINTQVTP
GEVSVQLHPGAEANFMLKVRPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMALY
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
AIAGEIESKAANLNNLVVEAYKKIISEVKVQLENQVHGVHFNITAICPDGARKPGISGCG
NVTSNDEVLFNVTVVMKTCDIMGGKNYAIIKPIGFNETTKVHIHRSCSCQCENHRGLKGQ
CAEAAPDPKCPQCDDSRCHFDEDQFPSETCKPQEDQPVCSGRGVCICGKCLCHKTKLGRV
YGQYCEKDDFSCPYLHGDVCAGHGECEGGRCQCFSGWEGDRCQCPSASAQHCVNSKGQVC
SGRGTCVCGRCECTDPRSIGRLCEHCPTCHLSCSENWNCLQCLHPHNLSQAALDQCKSSC
AVMEQHRMDQTSECLSGPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNNNKIKSSSDY
RMSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAQEAFRCNF
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctcggccctggcttttctgactgctgcactgctctctctgcacaactgccag
cgaggtccagccttggttcttggggcagcctgggtattttcacttgttctcggactgggc
caaagtgaacacaatagatgtggctctgcaaatgtggtctcctgtgccaggtgcctccag
ctgggtccggaatgcggatggtgtgttcaagaggattttgtttcaggtggatcaggaagt
gaacgttgtgatactgtttccagtttgataagcaaaggctgtccagttgattcaatagaa
tacctgtctgtgcatgttgtaacgtcaagtgagaatgaaatcaatacccaggtgacaccg
ggagaagtctcagtccaactgcatccaggagctgaagctaattttatgttaaaagtccgt
cctctgaagaaataccccgtggatctttattatctggttgatgtgtcagcatcaatgcac
aataatatagaaaaattgaattccgttggaaatgatttatctaaaaaaatggccctttat
tcccgtgacttccgtcttggttttggctcatatgtggataaaactgtctcgccatacatt
agtatccacccggaaaggatccacaatcagtgcagtgactacaatttagactgtatgcct
ccccatggatacattcatgtgctgtctctgacagaaaacatcactgagtttgaaaaagca
gtccacagacaaaagatctctggaaacatagacacccctgaaggaggttttgatgccatg
cttcaggctgccgtctgtgagagtcatattggatggcgaaaagaagctaaaagattgctg
ctggtgatgacagaccagacatcacatcttgctcttgacagcaaattggcaggcatagtg
gtgccgaatgacggaaactgccatctcaaaaacaatgtctacgtcaaatcgacaaccatg
gaacatccgtcattaggccaactttctgaaaagttaatagacaacaacataaatgtcatt
tttgcagttcaaggaaagcagtttcattggtacaaggaccttctgccccttttgcctggt
gccattgctggtgaaatagaatccaaagctgcaaatctcaacaatttagtagtagaagcc
tacaagaagattatctcagaagtaaaagtgcagctggaaaaccaggtacacggtgtccat
tttaacatcactgccatctgtccagatggggccagaaagccaggcataagtgggtgtgga
aacgtgacaagcaatgacgaagttcttttcaatgtaactgttgtgatgaaaacatgtgat
atcatgggaggaaaaaactatgcaataatcaagcctattggtttcaatgaaaccactaaa
gtccacatacacagaagctgcagttgccagtgtgagaaccacagaggactcaaaggacag
tgtgcggaagctgccccagaccccaagtgtccacagtgtgatgacagcagatgtcatttt
gatgaagaccagtttccttctgaaacttgcaagccacaggaggatcaacctgtctgcagt
ggccgaggtgtttgcatctgtgggaaatgtttatgtcacaaaaccaagctaggaagagtg
tatggccagtactgtgagaaggatgacttctcctgtccctatctccatggggatgtgtgt
gctgggcatggggagtgtgaaggtggcagatgccagtgctttagtggctgggaaggagat
cggtgtcagtgcccatcagcctcagcacagcactgtgtcaactccaagggccaagtttgc
agcgggagaggcacctgcgtgtgtggcaggtgtgagtgtactgatcccagaagcattggc
cgtctctgtgagcactgcccaacctgccatctctcctgcagtgaaaactggaattgtctg
cagtgccttcaccctcacaatctgtctcaggctgcccttgatcagtgtaaatcctcctgt
gctgtcatggaacagcatcgcatggaccaaacatcagaatgtttatctggcccaagctat
ctgcgaatatttttcatcatattcatagtcacattcttgatcgggttgcttaaagttctt
atcattagacaagtgatactacaatggaataataataaaataaagtcctcatcagattat
agaatgtctgcttctaaaaaggataaactgattctgcaaagtgtttgcacgagagctgta
acctaccgacgagaaaagcctgaggaaataaaaatggatatcagcaaactaaatgctcag
gaggccttcaggtgcaacttctaa

DBGET integrated database retrieval system