KEGG   Mus musculus (mouse): 328572Help
Entry
328572            CDS       T01002                                 

Gene name
Ep300, A430090G16, A730011L11, KAT3B, p300, p300_HAT
Definition
E1A binding protein p300 (EC:2.3.1.48)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    328572 (Ep300)
   04330 Notch signaling pathway
    328572 (Ep300)
   04350 TGF-beta signaling pathway
    328572 (Ep300)
   04630 Jak-STAT signaling pathway
    328572 (Ep300)
   04066 HIF-1 signaling pathway
    328572 (Ep300)
   04068 FoxO signaling pathway
    328572 (Ep300)
   04024 cAMP signaling pathway
    328572 (Ep300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    328572 (Ep300)
  Cell communication
   04520 Adherens junction
    328572 (Ep300)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    328572 (Ep300)
   04916 Melanogenesis
    328572 (Ep300)
  Nervous system
   04720 Long-term potentiation
    328572 (Ep300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    328572 (Ep300)
   05206 MicroRNAs in cancer
    328572 (Ep300)
   05203 Viral carcinogenesis
    328572 (Ep300)
   05211 Renal cell carcinoma
    328572 (Ep300)
   05215 Prostate cancer
    328572 (Ep300)
  Neurodegenerative diseases
   05016 Huntington's disease
    328572 (Ep300)
  Infectious diseases
   05152 Tuberculosis
    328572 (Ep300)
   05166 HTLV-I infection
    328572 (Ep300)
   05164 Influenza A
    328572 (Ep300)
   05161 Hepatitis B
    328572 (Ep300)
   05168 Herpes simplex infection
    328572 (Ep300)
   05169 Epstein-Barr virus infection
    328572 (Ep300)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     328572 (Ep300)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    328572 (Ep300)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    328572 (Ep300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E1; 15
AA seq 2412 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINS
MVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLA
AGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGP
QPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGM
PSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
IPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINS
QNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
NAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMN
MPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTN
MPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTP
TPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSL
PAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTE
VNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKT
DGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDP
QLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKY
CSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFC
EKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLH
HEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEV
TVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEY
GSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPS
EGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKEL
PYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKS
SLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPC
DLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRW
HCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQS
LVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKC
PVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQ
QPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLP
GPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGH
LDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVS
PLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQP
LPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMG
AMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQ
QQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQH
MLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADL
NSNLSQSTLDIH
NT seq 7239 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaacccgggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggttcactgtttgacctggaa
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggcgat
atcagtcagcttcagacaagtcttggcatagtacaagatgcagcctcgaaacataaacag
ctgtcagaactgctgaggtctggtagctccccaaacctcaacatgggagtcggtggccca
ggccaagcgatggccagccaggcccaacagaacagccctggattaagtttgataaatagc
atggtcaaaagcccaatggcacagacaggcttgacttctccaaacatggggattggcagt
agtggaccaaatcagggtcctactcagtccccagcaggtatgatgaacagtccagtgaac
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggct
gcaggcaatggacaagggataatgcccaatcaagtcatgaacggttccattggagcaggc
cggggacggccaaacatgcagtacccaaatgcaggcatgggcaatgctggcagtttattg
actgagccactacagcagggctctcctcagatgggaggacagccaggattgagaggcccc
caaccacttaagatgggaatgatgaacaatcccagtccttatggttcaccatacactcag
aattctggacagcagattggagcaagtggccttggtctccaaattcagacaaagactgtt
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtgggggaatg
cccagtatgggccagcagcctaccccatcggtccagcagccaggcctggtgactccagtt
gccgcaggaatgggttctggagcacacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttacatgctcacaagtgccagcgccgggagcaagctaatggg
gaagtgaggcagtgcaaccttcctcactgtcgtaccatgaaaaatgtcctaaaccatatg
acacattgccagtcaggcaaatcctgccaagtggcacattgtgcatcttctcgacaaatc
atttcacactggaaaaattgcacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagcgaaatcaacagtcaattttgactggagcaccagttgggcttggaaac
cctagctctctaggagtggggcagcagtccactcctagcctaagcactgttagtcagatt
gaccccagctctatagagcgagcttacgctgctcttggactaccctatcaagtaaaccag
attccaccacaaccccaggtacaagcaaagaatcaacaaagccagccatctggacagtct
ccccagggcatgcggtctgtgaacaacatgagtgctagtcctatgggtgtaaatggaggt
gttggggttcagacgccaaatcttctttctgactccatgttgcattcaactataaattct
caaaacccaatgatgagtgaaaatgctggtgtggcctccctgggtcctttgccaacagca
gctcagccatctagtactggaattcgaaaacagtggcatgaagatattactcaggatctt
cgaaaccaccttgttcataaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagaccgacggatggaaaatcttgttgcatatgctcgtaaagtggaaggggacatg
tatgaatctgcaaacaatagagcggaatactatcacctcctagccgagaagatctataag
atccagaaggaactagaagagaaacgaaggactagactacagaaacagaacatgctaccg
aatgctcctggcatgggtccagttcctatgaatactgggtcgaacatggggcagcaacca
acaggaatgactaccaatggtcctgtacctgacccgtctatgatccgtggcagtgtgccg
aaccacatgatgcctcggatgactccacagcctggtttgaatcaatttgggcagatgaat
atgccacagccccctattggaccccggcaaccctctcctcttcagcaccatggacaattg
gctcagtctgggtcactcaatccgcctatgggctatggacctcgcatgcagcaggcttcc
ggccagaaccagttcctctcccagactcagttcacatcccaaggaatgaatgtaacaaac
atgcctttggctccatccagcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcttgcccagtgaactctcctataatgcctccagggtctcaagggagccacattcactgt
cctactctgcctcaacaagctcatcagaattcaccttctcctgttcctagccgcacccct
actcctcatcatacccccccaagcatagggaatcaaccaccaccagcaacagcaattcca
acacctgttcctacacctcctgccataccacctggaccacagcccccatctctgcatccc
tcatctagacaaacacctacaccaccaacacatctgcctccccaagtgcagccttcactt
cctgctgctccttctgctgaccagtcccagcaacagcctcggtcacagcagagcacagca
gtttctgttcctaccccaacagcaccattgctgcctcctcagccttccactccgctttct
cagccagctgtgagcattgaaggccaggtctcaaaccctccatctactagtagcaccgaa
gtgaattctcagaccattcctgagaagcagccttcacaggaagtgaaaatggagtctaaa
atggaggtggataagccagaaccagcagatgctcaacctgaggatacaaaggaggctaaa
ggtgaggatgttaaagtagaacctacagaaatggaggagagaggccctgagttaaaaact
gatgggaaagaggaggaagaacagccaagcacctctgctacccagtcctccccagctcct
ggacagtcaaagaagaagattttcaaaccagaggaattacgacaggctctgatgccaaca
ttggaggcactttaccggcaggacccagaatctcttccctttcgtcagcctgtggacccg
cagcttctaggaatccctgattactttgatattgtgaagagccccatggatctttctaca
atcaagaggaagttagatactggacaataccaagagccctggcaatatatagatgatatt
tggcttatgttcaacaatgcctggttatataaccgtaaaacttcaagggtatacaaatat
tgctctaaactttctgaagtatttgaacaagaaattgaccctgtcatgcaaagccttgga
tactgttgtggcagaaagttggagttttctccacagactctttgttgctatgggaaacag
ttatgcacaatcccccgtgatgctacttactacagttaccagaacaggtatcatttctgt
gagaagtgtttcaatgaaatccaaggggagagcgtttctttgggtgatgacccttcccaa
cctcaaactacaataaataaagaacagttttccaagagaaaaaatgacacgttggatcct
gaactgtttgttgagtgcacagagtgtggaagaaagatgcaccagatctgtgtccttcac
cacgagatcatctggccatctgggtttgtctgtgatggctgtttaaagaaaactgcacga
actaggaaagaaaataagctttctgctaaaagattgccatctaccagacttgggaccttt
ctggagaatcgagtgaatgactttctgaggcgacaaaatcaccctgaatcaggagaggtc
actgttcgggttgttcatgcttctgacaaaactgtggaagtgaaaccaggcatgaaagca
aggtttgtagatagtggagagatggcagaatcttttccataccgaacaaaggccctgttt
gcctttgaagaaattgatggtgttgacttgtgtttcttcggcatgcatgttcaagaatat
ggctctgactgcccccctcccaaccagaggagggtatacatatcttacctcgatagtgtt
catttcttccgtcctaaatgcttgcggactgcagtctatcatgaaattctaattggatat
ttggaatatgtcaagaaattaggatacacaacagggcacatctgggcctgtccacccagt
gaaggggatgactatatcttccattgccatccacctgatcagaagataccaaagcccaag
cgcctgcaagaatggtacaaaaagatgcttgacaaggctgtatcagaacgtattgtccat
gactacaaggatattttaaaacaagctactgaagatcgattaacaagtgcaaaggaacta
ccctactttgaaggtgatttctggcccaatgttctagaagaaagcatcaaggagcttgaa
caggaagaggaagagaggaaacgggaagagaacaccagcaacgagagtactgatgtaaca
aaaggagacagcaaaaatgctaagaagaagaataacaagaaaaccagcaaaaacaagagc
agcctgagtaggggcaataagaagaagcctggtatgcccaatgtgtctaatgacctttct
cagaaactgtatgccaccatggaaaagcataaagaggttttctttgtgatccgcctcatc
gcttgtcctgctcccaattccctgcctcccattgttgatcctgaccctctcatcccctgt
gacctgatggacggtagagatgcatttctcacccttgcaagggacaagcacctggagttc
tcttcacttcgaagagcccagtggtctaccatgtgcatgctggtggagctccatacacag
agtcaggatcgctttgtctacacctgcaacgagtgcaagcaccacgtggagacacgctgg
cattgcactgtgtgtgaggattatgacctgtgcatcacttgttataacactaaaaatcat
gaccacaaaatggagaaactaggccttggcttagatgatgagagcaataaccagcaagct
gcagctacacagagcccaggagactcccgccgcctgagcatccaacgctgcatccagtct
ctggtgcatgcctgtcagtgccgcaacgccaactgctccctgccttcctgccagaagatg
aagagggttgtgcagcacaccaaaggctgcaaacggaaaaccaatggtgggtgccccatt
tgcaaacagcttattgccctctgctgctatcatgccaagcactgccaggagaacaagtgc
ccggtgccattttgcctcaacatcaagcaaaagctccggcagcaacagctgcagcaccgg
ctccaacaggctcagatgctccgtaggaggatggccagcatgcaacgaactggtgtggcg
gggcagcagcagggcctgccgtccccaactcctgctacaccaactacccctactggccaa
cagccagccaccccacagacaccccagccccaacccacctctcaaccacagcccactcct
cccaacaacatgacaccctacttacccaggactcagactactggccctgtgtcccagggt
aaggcaccaggccaggtgaccccacctaccccacctcagactgctcaggccccccttcca
gggcctccacctgcagcagtagaaatggcaatgcaaattcagagggcagcagagacacag
cgccagatggcccatgtacagattttccaaaggccaatccagcaccagatgccccagatg
tcacccatggcccctatgggcatgaacccacctcctatggccagaggtcctggtgggcat
ttggatccaggaataggtccagcaggaatgcagcaacagccaccttgggcccaaggagga
atgcctcagccccagcagatgcagtcagggatgccaaggccagccatgatgtcagtggcc
cagcatggtcagcctttaaacatggctccacaaccaggattgggccaagtgggtgtgagc
cctctcaagccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcagg
tctcccagttctcccttacagcagcaacaggtgcttagtatccttcatgccaacccccaa
ctgttggctgcattcatcaagcagcgggctgccaagtatgccaaccctaatccacagcct
ctccctggacagcctggcatgacccagggacagccagggctgcagccacctaccatgcct
ggccagcaaggtgtccactccaacccagccttgcagaacatgaatcctctgcaggcaggt
gtccagagagctggcctgccccagcagcagccgcagcagcagctccagccacccatggga
gcaatgagtccccaagctcagcaaatgaacatgaatcacaataccatgccttcacagttc
agagacatcttaagacggcagatgatgcaacagcagggagcagggccaggaatcggccct
ggaatggccaaccagttccagcagccccaaggaattggctatccaccgcagcagcagcag
cagcagcgaatgcagcatcacatgcagcaaatgcagcaaggaaatatgggacaaatgggt
cagcttccccaggctctgggggctgaggcaggagccagtctacaggcctatcagcagcga
cttcttcaacaacagatggggtctcctgctcagcccaaccctatgagcccacagcagcac
atgctcccaaatcaggcacagtccccacacctacaaggtcaacaaatccctaattctctc
tccaatcaagtgcgctctccccagcctgtcccttctcctcgaccacagtctcagcccccc
cattccagcccatctccgaggatgcagcctcagccttctccacaccatgtttctccacag
accagttccccacatcctggactggtagctgcccaggctgccaaccctatggaacaaggg
cattttgccagcccagaccagaattcaatgctttcacagctcgctagcaatcctggcatg
gcaaacctccacggggcaagtgccacggacctgggactgagcagcgataatgcagacttg
aattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system