KEGG   Mus musculus (mouse): 328778Help
Entry
328778            CDS       T01002                                 

Gene name
Rab26, A830020M03Rik
Definition
(RefSeq) RAB26, member RAS oncogene family
  KO
K07913  
Ras-related protein Rab-26
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    328778 (Rab26)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab26/37
    328778 (Rab26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 A3.3
AA seq 260 aa AA seqDB search
MSRKKTPKSKGGSEPATSTLPAAAAATNGPRLAHPRTVRPGPEAPPNGPPQSIRPSLGST
GDFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGMKVKLQ
IWDTAGQERFRSVTHAYYRDAHALLLLYDITNKDSFDNIQAWLTEIQEYAQQDVVLMLLG
NKVDSTQDRVVKREDGEKLAKEYGLPFMETSARTGLNVDLAFTAIAKELKQRSAKAPSEP
RFRLHDYVKREGRGVSCCRL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggaagaagacccccaagagcaagggggggagtgagccggctacctctacgctg
cccgccgccgccgccgccaccaatgggccacgtctggcacatccgaggactgtgcgccct
ggcccagaggcaccgcccaatgggcccccgcagtccatccggccctcacttggtagcact
ggagacttctacgatgttgctttcaaggtcatgctggtgggggattccggtgtggggaag
acctgcctgcttgtgcgcttcaaggatggggctttcctggctggtaccttcatctccact
gtgggcatcgacttccggaataaagttctggatgtggatggcatgaaggtgaagctgcag
atctgggacacagctggtcaggagcggttccgaagtgtcacccatgcctactaccgagat
gctcacgcactgttgctgctctacgacatcaccaacaaagattccttcgacaacattcag
gcctggttgacagagatccaggaatatgcccagcaggatgtggtgctcatgctgctaggg
aacaaggttgactctactcaagaccgtgtggtaaagagggaagatggggagaaattagcc
aaggagtatgggctacctttcatggagaccagcgcaaggactggcctcaacgtggacttg
gcttttacagccatagcaaaggagctgaaacagagatcagccaaggctcccagcgagccg
cgcttcaggctgcatgactatgttaagagggagggccgaggggtctcctgctgtcgactc
tga

DBGET integrated database retrieval system