KEGG   Mus musculus (mouse): 329065Help
Entry
329065            CDS       T01002                                 

Gene name
Scd4, ACOD4
Definition
stearoyl-coenzyme A desaturase 4
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mmu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mmu01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mmu03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 C3; 19
AA seq 353 aa AA seqDB search
MTAHLPQEISSRCSTTNIMEPHSRRQQDGEEKMPLQAEDIRPEIKDDLYDPSYQDEEGPP
PKLEYVWRNIIFMALLHVGALYGITLVPSCKVYTWLLGVFYNVVAGLGITAGAHRLWSHR
TYKARLPLRIFLIMANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLL
VRKHPAVKEKGKNLDMSDLKAEKLVMFQRRYYKLAVTLMFIILPTLVPWYLWGETFQHSL
CVSNFLRYAVLLNFTWLVNSAAHLYGYRPYDRGIGARENPFVSMASLGEGFHNYHHTFPY
DYSVSEYRWHINFTTFFIDCMAALGLAYDRKKVSKAVVLARIKRTGDGSHKSS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccacttgccacaagagatctccagcaggtgtagcactaccaacatcatggaa
ccccactcccggagacagcaggatggagaagagaagatgcccctccaggcagaagatatc
cggcctgaaataaaagatgatctgtatgaccccagctaccaggatgaggagggacccccg
cccaagctggagtacgtctggaggaacatcatcttcatggccctgctgcacgtgggagcc
ctgtacgggatcacactggttccctcctgcaaggtctacacctggctcttgggagtattc
tacaacgtggttgccggtttgggcatcacagccggagcgcatcgcttgtggagccaccga
acctataaagcaaggctgcccctacgcatcttcctcatcatggccaataccatggctttc
cagaatgacgtgtatgaatgggcccgagatcaccgcgcccaccacaagttctcagaaaca
cacgccgaccctcacaattcccgccgtggcttcttcttctctcacgtgggttggctgctt
gtgcgcaaacatccggctgtcaaagagaagggcaaaaacctggacatgtctgacctgaaa
gccgagaagctggtgatgttccagaggaggtactacaagctagctgtcacgctcatgttc
atcattctgcccacactggtaccctggtacttgtggggtgagacttttcaacacagctta
tgcgtctcgaatttcctgcggtatgctgtgcttctaaacttcacttggctggtgaacagt
gcggcccacctctacggataccggccctatgacaggggcattggtgcccgggagaatccc
ttcgtttcaatggcatctttaggcgagggcttccacaactaccatcacacgttcccctac
gattactctgtcagtgagtaccgctggcacatcaacttcaccacgtttttcatcgactgc
atggctgccctgggcctggcttacgaccggaagaaagtatctaaggccgttgtcttagcc
aggattaagagaactggagatgggagtcacaagagtagctga

DBGET integrated database retrieval system