KEGG   Mus musculus (mouse): 329065Help
Entry
329065            CDS       T01002                                 

Gene name
Scd4, ACOD4
Definition
stearoyl-coenzyme A desaturase 4
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    329065 (Scd4)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    329065 (Scd4)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    329065 (Scd4)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    329065 (Scd4)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     329065 (Scd4)
Lipid biosynthesis proteins [BR:mmu01004]
 Desaturase
  First
   329065 (Scd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 C3; 19
AA seq 353 aa AA seqDB search
MTAHLPQEISSRCSTTNIMEPHSRRQQDGEEKMPLQAEDIRPEIKDDLYDPSYQDEEGPP
PKLEYVWRNIIFMALLHVGALYGITLVPSCKVYTWLLGVFYNVVAGLGITAGAHRLWSHR
TYKARLPLRIFLIMANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLL
VRKHPAVKEKGKNLDMSDLKAEKLVMFQRRYYKLAVTLMFIILPTLVPWYLWGETFQHSL
CVSNFLRYAVLLNFTWLVNSAAHLYGYRPYDRGIGARENPFVSMASLGEGFHNYHHTFPY
DYSVSEYRWHINFTTFFIDCMAALGLAYDRKKVSKAVVLARIKRTGDGSHKSS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccacttgccacaagagatctccagcaggtgtagcactaccaacatcatggaa
ccccactcccggagacagcaggatggagaagagaagatgcccctccaggcagaagatatc
cggcctgaaataaaagatgatctgtatgaccccagctaccaggatgaggagggacccccg
cccaagctggagtacgtctggaggaacatcatcttcatggccctgctgcacgtgggagcc
ctgtacgggatcacactggttccctcctgcaaggtctacacctggctcttgggagtattc
tacaacgtggttgccggtttgggcatcacagccggagcgcatcgcttgtggagccaccga
acctataaagcaaggctgcccctacgcatcttcctcatcatggccaataccatggctttc
cagaatgacgtgtatgaatgggcccgagatcaccgcgcccaccacaagttctcagaaaca
cacgccgaccctcacaattcccgccgtggcttcttcttctctcacgtgggttggctgctt
gtgcgcaaacatccggctgtcaaagagaagggcaaaaacctggacatgtctgacctgaaa
gccgagaagctggtgatgttccagaggaggtactacaagctagctgtcacgctcatgttc
atcattctgcccacactggtaccctggtacttgtggggtgagacttttcaacacagctta
tgcgtctcgaatttcctgcggtatgctgtgcttctaaacttcacttggctggtgaacagt
gcggcccacctctacggataccggccctatgacaggggcattggtgcccgggagaatccc
ttcgtttcaatggcatctttaggcgagggcttccacaactaccatcacacgttcccctac
gattactctgtcagtgagtaccgctggcacatcaacttcaccacgtttttcatcgactgc
atggctgccctgggcctggcttacgaccggaagaaagtatctaaggccgttgtcttagcc
aggattaagagaactggagatgggagtcacaagagtagctga

DBGET integrated database retrieval system