KEGG   Mus musculus (mouse): 329908Help
Entry
329908            CDS       T01002                                 

Gene name
Usp24, 2700066K03Rik, 2810030C21Rik, AI414051, B130021E18, C79851
Definition
ubiquitin specific peptidase 24 (EC:3.4.19.12)
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     329908 (Usp24)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   329908 (Usp24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C7; 4
AA seq 2617 aa AA seqDB search
MESEEEQHMTTLLCMGFSDPATIRKALRLAKNDINEAVALLTNERPGLDYGGYEPMDSGG
PSPGPGGGPRGDSGSDGSGPSRGGSTGGGGGFDPPPAYHEVVDAEKNDENGNCSGEGIEF
PTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSESDENCKRFMERCMPEA
FKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERMKQDPIPIGLLGVLTMAFNPDNEYH
FKNRMKVSQRNWAEVFGEGNMFAISPVSTFQKEPHGWVVDLVNKFGELGGFAAIQAKLHS
EDIELGAVSALVQPLGVCAEYLNSSVVQPMLDPVILTTIQDVRSVEEKDLKDKRLVSIPE
LLSAIKLLCMRFQPALVTTVDALRLDILLRMLKSPHFSAKMNSLKEVTKLIEDSTLSKSV
KNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDELTKIWKIQS
GQSSTVIENIHTIIAAAAVKFNADQLNHLFVLIQKSWETESDRVRQKLLSLIGRIGREAR
FEATSGKVLDVLWELAHLPTLPSSLIQQALEEHLTILSDAYAVKEAVKRSYIIKCIEDIK
RPGEWSSLEKNKKDGFKSSQLNNPQFVWVVPALRQLHEITRSFIKQTYQKQDKSIIQDLK
KNFEIVKLVTGSLLACHRLAAAVAGPGGLTGLTLVDGRYTYREYLEAHLKFLAFFLQEAT
LYLGWNRAKEIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKLESYE
ITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEKLELVGMDFIWKIAMESPDEEIANEAI
QLIINYSYINLNPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATKMLTAT
AMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDFYSVPRTILPHGASFHGHLLTLN
VTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSPVDNIQIFTNDSLLTVNKDQKLLHQLG
FSDEQVLTVKTSGSGTPSGSSADSSTSSSSSSSGAFSSSYAMEQEKSLPGVVMALVCNVF
DMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSETSSQSSKSPS
LSSKQQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDDMARSCAKSFCE
NFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTSLDEDLTKD
GIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQTME
ASDFTATVACFMRLSWAAAAGRLDLVGSSQPIKESNSLFPAGIRSRLSSSGSNCSSSSEG
EPAALHAGICVRQQSVSTKDALIAGEALSLLVTCLQLRSQQLASFYSLPCVADFIIDILL
GSPSAEIRRVACDQLYTLSQTDTSAHPEVQKPNQFLLGVILTAQLPLWSPTSIMRGVNQR
LLSQCMEYFDLRCQLLDDLTTSEMDQLRISPATMLEDEITWLDNFEPNRTADCETSEADN
ILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRIIVNSHSPASSAAISQQD
FHPKCSTVNSRLAAYEVLVMLADSSPSNLQIITKELLSMHHQPDPALTKEFDYLPPVDSR
SSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSLFGHLM
ESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKMGREQIFKNTFQ
GIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSNAYYCEKCK
EKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPYTVAGMARQ
DSSSEVGENGRNMDQGGGGSPRKKVALTENYELVGVIVHSGQAHAGHYYSFIKDRRGCGK
GKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNPYTDVRRRYWNAYMLFYQRVS
DQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNNDRLSILTKLVKKGE
KKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKLKHPYYPCMAK
VSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSLDACQWLVEYFISSEGRELVK
VFLLECSVREVRVAVATILEKTLDSALFYQDKLKSLHQLLEVLLALLDKDVPENCKNCAQ
YFSLFNTFVQKQGIRAGDLLLRHSALRHMISFLLGVSRQNSQIRRWSSAQAREFGNLHNT
VALLVLHSDVSSQRNVAPGIFKQRPPISVAPSSPLLPLHEEVEALLFLSEGKPYLLEVMF
ALRELTGSLLALMEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEVLVIE
DPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKENSHH
WSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSN
GSESSPANENGERHLQQGSESPMMIGELRSDLDDVDP
NT seq 7854 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggaggaggagcagcacatgaccacgctgctgtgcatgggcttctcggacccg
gccaccatccgcaaggccctgcgcctggccaagaacgacatcaacgaggccgtggcgctg
ctcaccaacgagcggcccggcctcgactacggtggctacgagcccatggatagcggcggc
cccagtccggggccgggcggcggcccacggggcgacagcggcagcgacggcagcgggcct
tcccgcggcgggagcaccggaggtggtggcggcttcgatcccccgcccgcctaccacgag
gtggtggacgcggagaagaacgatgaaaatggaaattgctcaggagaaggaattgaattt
cctacaaccaatttgtatgagctggaaagccgcgttttgactgatcattggtctatcccg
tacaagagagaagagtcattaggcaaatgcctgctggcttccacctacttagccagactt
ggtctttcagagtctgatgagaattgcaaaagatttatggagcggtgtatgcccgaggca
tttaagaagctcctgacatcaagtgctgttcacaagtggggtactgaaattcatgaagga
atctacaacatgttgatgctactaatagaattggttgcagagaggatgaaacaggatcca
attcccattggtcttctaggtgtgcttacaatggctttcaatcctgataatgaataccac
tttaaaaacagaatgaaagtgtctcagaggaactgggcagaggtgtttggagagggaaat
atgtttgctatttcacctgtatctactttccaaaaggagcctcatggatgggtggtggac
ttggtaaataagtttggagaattaggtggatttgcagcaatccaagccaaactccattca
gaagatatagaacttggggccgtgtcagcactggtgcagcccttaggggtgtgtgcagag
tacctcaactcctctgtggtgcagcctatgctagacccggtcatccttaccacaatccag
gacgtgcggagtgtagaggagaaggacctcaaagacaagaggctggttagcatccccgag
ctcttgtctgccattaagttgctttgcatgcgcttccaaccggctctggtgacgaccgtg
gacgcccttcgcctggacatcctgctgcgcatgctcaagtcaccacacttcagtgcgaaa
atgaattccctcaaggaagtaacaaaactaatagaagatagtactctatccaagtctgtg
aagaatgctatagatacagacagattactagattggctagttgaaaattcagttctgtca
attgcactagaaggcaacatagaccaagcacaatactgtgatcgaataaagggaattatt
gaactcttgggcagtaaattgtcactagatgaactcactaaaatttggaagatacaatca
ggacagtcatctacagtaattgagaacattcatacaattattgctgcggcagctgtgaag
tttaatgcagaccagcttaatcatttgttcgtccttattcagaagagctgggagaccgag
agtgacagagtgagacagaagttgctgagtctgatcggacgaatcggccgggaagctcgg
tttgaggccacttctggaaaggtgttagatgtcctctgggagctggctcaccttcccacc
ttgcccagcagcctcattcagcaggccttggaggagcacctcaccatcctcagtgacgcg
tacgcagtgaaggaggcggtcaagaggagctacatcattaaatgcatagaagacattaaa
aggcctggagaatggtcgagtttggagaaaaacaagaaagatggatttaagtcatctcaa
cttaataatccgcagtttgtgtgggtggttccagctttacgtcagcttcatgaaatcact
cgttcatttataaaacaaacctatcaaaagcaagacaagagcattattcaagacctgaag
aaaaattttgaaatagtcaaactggtaacgggaagcttactggcttgtcaccgacttgca
gcagccgtggctgggcctggaggcttaaccggcttaacattggtggatggccgctatact
taccgggagtatttagaggcacatctgaaatttctggcatttttcttacaagaagctaca
ctgtatcttgggtggaaccgagccaaagaaatttgggagtgccttgtgactggccaggac
gtctgcgagctagatagagagatgtgctttgagtggtttacaaaggggcagcatgacctg
gagagtgacgtccagcagcagctcttcaaggagaagattctgaaattggagtcatatgaa
atcactatgaatggtttcaacttatttaagactttttttgaaaatgtgaatctctgtgat
catcggttgaaaagacaaggagctcagttgtatgtagaaaagttggagttggtaggaatg
gatttcatttggaaaattgccatggaatcacctgatgaagaaattgctaatgaagctatt
caattaatcataaactacagttacattaatctaaaccctaggttaaagaaggactcagtg
tctttacataagaaattcattgctgactgctatacaagactagaagcagccagttcagca
ctcggtggccccactctaacacatgctgtgacccgagcaaccaaaatgctcactgcaact
gccatgccaactgtagcaacatcagttcagtctccatatagatcaacaaaacttgtgata
atcgagagactgctgcttctggcggagcgctacgtgatcacaatagaggacttctactct
gtcccacgaactattctacctcatggtgcctcatttcatggacatcttttaactcttaat
gttacctacgagtctaccaaagataccttcactgtagaggctcacagtaatgagacgata
ggcagcgtccgctggaagatagccaaacagctgtgctctcctgtggacaacatacagata
tttacgaacgatagtctgctgactgtaaataaagatcaaaagctcctccaccaactgggg
ttctctgatgaacaagttcttaccgtgaagacttctggcagtgggaccccctcggggagc
tctgcagattcctccaccagctccagcagcagcagcagtggggccttcagttcgtcctac
gccatggaacaggagaaatctctccctggtgtggtgatggcacttgtatgtaatgtgttt
gacatgctgtaccaacttgccaacctggaggagccaaggataactctacgagtgcggaag
cttctgctcttgatacccactgacccagccattcaggaagcccttgaccagctggattct
ttaggcagaaagaaaactttgctctctgaaacaagctcccagtcttcaaagtctccttcg
ctttcgtcaaagcagcagcatcagccaagtgccagctccatcttggaaagtttgtttcga
tcttttgctcctggcatgtcaaccttcagagtgctctacaacttggaagtcctaagctcc
aaactcatgcccacggctgatgacgacatggcaagaagctgcgcaaagtccttctgtgag
aacttcctcaaagctggaggcttgagtttggttgtaaatgtcatgcagagagattccatc
ccatcagaggtggactatgagacaaggcagggtgtttattctatctgtctacaacttgca
aggtttttacttgttggacagacaatgccaacatcattagatgaagacctcaccaaagat
ggcatagaagcactttcttcccgtccattccgaaatgtcagccggcagacgagcagacag
atgtccctatgtgggaccccagagaagtcgtcctacagacagctgtcagtgtcagacagg
tcttccattagggttgaggaaatcattcccgctgctcgagttgcaatacaaactatggaa
gcaagtgatttcactgccaccgtagcttgtttcatgagactgtcatgggctgcagctgca
ggacggcttgaccttgtcggaagtagccagccaattaaagaaagcaattctctgtttcct
gctgggatcagaagtagactcagcagctcaggaagcaattgcagctctagcagtgaagga
gagccagcagccctgcatgctgggatctgcgtccggcagcagtctgtgtccaccaaagat
gccctgattgctggagaggctttgtctcttcttgttacgtgcctgcagcttcggagtcag
caactggcgtctttctacagcttaccatgtgttgctgattttatcatcgatattctgctc
ggatcaccaagtgctgagatccgccgggtcgcctgcgatcagctctacactcttagtcaa
acagacacttcggcccatccagaagtgcagaagccaaatcagttcctcctaggagtcatt
ctcacggcccagctgcctctctggtccccgaccagtatcatgagaggagtcaatcagaga
ctactgtctcaatgtatggagtattttgatttgcggtgccagttattagatgatctgaca
acttctgaaatggaccagttaagaatcagccccgctaccatgcttgaagatgagattaca
tggctggataactttgaacctaatcgaacagcagactgtgagactagcgaagctgacaac
atcctattggcaggacatttgcggctcattaagaccctgctatcactctgtggggcagaa
aaggaaatgcttggttcatcactgattaagccattgttagatgacttccttttccgagct
tctagaattattgtaaatagtcattctccagccagcagtgccgccatcagtcagcaggac
tttcatccaaagtgtagtacagtaaatagccggttggcagcctatgaagttcttgtgatg
ttagctgacagctcaccttcaaatcttcagattattacaaaagaactactttcaatgcat
catcagcctgaccctgctctcaccaaggagtttgattacctgcccccggtggatagcagg
tccagctcagggtttgtggggctgaggaacggtggcgctacttgttacatgaatgcggtc
ttccagcagctgtatatgcagcccgggcttccggagtcactgctttcagtggatgatgac
acagacaatccagatgacagtgtgttttaccaagtgcagtctctctttgggcatttgatg
gagagcaagctgcagtattatgtgcctgagaatttctggaagatcttcaagatgtggaac
aaggagctctatgtgagggagcagcaggatgcatatgagttcttcactagcctcattgat
cagatggatgagtatctcaagaaaatgggacgagaacaaatttttaagaatactttccaa
ggcatctattctgatcagaagatctgcaaagattgtcctcacagatatgagcgtgaggaa
gctttcatggctctcaatctaggagttacgtcttgccaaagcttggaaatttctttggac
cagtttgttagaggtgaagttctagaaggaagtaatgcatactactgtgaaaagtgtaaa
gagaagagaataacagtgaagagaacgtgcattaagtctttacctagtgtgttggtaatc
cacctgatgagattcggctttgactgggagagcggacggtccattaaatacgatgagcaa
atacggtttccttggatgctaaatatggagccttacacagttgcaggaatggctcgccag
gattcatcttctgaagttggtgaaaatgggaggaatatggatcaaggaggtggaggatcc
ccacggaaaaaagttgccctcacagaaaactatgagcttgttggtgtcattgtgcacagt
gggcaggcccatgcaggccattactattccttcattaaggacaggcgggggtgtggaaaa
ggaaagtggtataaatttaatgacaccgttattgaagaatttgacctaaatgatgagacc
ctggagtatgaatgctttggaggagaatatagaccaaaagtttatgatcaaacaaaccca
tacactgacgtccgtcgaagatactggaatgcctacatgctcttctatcaaagggtgtcc
gatcagaactcacccgtgctgccaaagaaaagccgagtgagcgtcgtaaggcaggaggct
gaggatctctctctgtcagctccatcttcacctgagatttcacctcagtcctctcctcgg
ccccacaggcctaataatgacaggctgtctattctaaccaagctggttaaaaaaggtgag
aagaaaggactgtttgtggagaaaatgcctgctcggatataccagatggtgcgagatgaa
aacctcaagttcatgaagaacagagatgtgtacagtagtgactacttcagttttgttttg
tccttagcttccttgaatgctactaaattaaagcacccatattatccttgcatggcaaaa
gtgagcttgcagcttgccattcaattccttttccaaacttacctacggacaaagaaaaaa
ctcagggttgacactgaagaatggattgctactattgaagcattactttcaaaaagtttg
gatgcttgtcagtggcttgttgaatattttattagctctgaaggacgagaattggtaaag
gttttcttgttggagtgcagtgtgagagaagtacgagtcgctgtggccaccattctggag
aagaccttagacagtgccttgttttatcaggataagttaaaaagccttcatcagttattg
gaagtcctgcttgctcttttggataaagatgtcccagaaaattgtaaaaactgtgctcag
tacttttctctattcaacacttttgtacaaaagcaaggtatcagggctggagaccttctt
ctgcggcactcagcactgcgacacatgatcagcttcctccttggggtcagccgacagaac
agtcagatacgcagatggagttcagcacaagcacgggagtttgggaatcttcacaacact
gttgccctgctggtcctgcattcggatgtctcttcacagaggaatgttgctcctggaata
tttaaacaacgaccacctattagtgtcgctccttccagccctctgctgcccctccatgag
gaagtagaagccttgctgttcttgtcggaagggaagccttatctgttagaggtcatgttt
gctctgcgagagctcactggctccctcctggcgctcatggagatggtggtgtactgctgt
ttctgcaatgagcacttttccttcacgatgctgcatttcattaagaaccagctagaaact
gctccaccccatgagttaaagaatacattccagctactgcatgaggtcctggtcattgaa
gatcccatccaggtagagcgcgtcaagtttgtatttgagacagaaaatggattactagca
ctgatgcaccatagcaatcatgtggacagcagccgttgctaccagtgtgtcaagtttctt
gtcactcttgctcaaaagtgccctgctgctaaagaatacttcaaagagaactcccaccac
tggagctgggctgtgcagtggttacagaagaagatgtcagagcattattggactccacag
agcaatgtctctaatgaaacttcaactggaaaaacctttcagcgaaccatctcagctcag
gacacattagcatacgccacagccttgttgaatgaaaaagagcaatcaggaagcagcaat
gggtccgagagcagtcctgccaatgagaacggagagcgacacttacagcagggttcggaa
tctcccatgatgattggtgaattaagaagtgaccttgatgatgttgatccttag

DBGET integrated database retrieval system