KEGG   Mus musculus (mouse): 329954Help
Entry
329954            CDS       T01002                                 

Gene name
Catsper4, 4933412L05
Definition
(RefSeq) cation channel, sperm associated 4
  KO
K16892  cation channel sperm-associated protein 4
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  CatSper and two-pore channel
   329954 (Catsper4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 329954
NCBI-ProteinID: NP_808534
MGI: 3043288
Ensembl: ENSMUSG00000048003
Vega: OTTMUSG00000020429
UniProt: Q8BVN3
Position
4; 4 D3
AA seq 442 aa AA seqDB search
MSEKHKWWQQVENIDITHLGPKRKAYELLGRHEEQVLINRRDVMEKKDAWDVQEFITQMY
IKQLLRHPAFQLLLAFLLLSNAITIALRTNSYLGQKHYELFSTIDDIVLTILICEVLLGW
LNGFWIFWKDGWNILNFAIVFILFMGFFIKQLDMVAITYPLRVLRLVHVCMAVEPLARII
KVILQSMPDLANVMALILFFMLVFSVFGVTLFGAFVPKHFQNMGVALYTLFICITQDGWL
DIYTDFQMDEREYAMEVGGAIYFAVFITLGAFIGLNLFVVVVTTNLEQMMKTGEEEGHLN
IKFTETEEDEDWTDELPLVHCTEARKDTSTVPKEPLVGGPLSNLTEKTCDNFCLVLEAIQ
ENLMEYKEIREELNMIVEEVSSIRFNQEQQNVILHKYTSKSATFLSEPPEGANKQDLITA
LVSREKVSDSNINMVNKHKFSH
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaacacaagtggtggcagcaggtggagaacatcgacatcacacacctgggc
cctaagagaaaagcctatgaactcctgggtcggcatgaggagcaagtgctcatcaaccgc
agagatgtcatggagaagaaggatgcctgggatgtacaggaattcatcactcaaatgtat
atcaagcagttgctccgccatccggccttccagctgctgctggcctttctgctgctgtcc
aacgctatcaccattgcccttcgcaccaactcttatctcggtcagaaacattacgagcta
ttctcgaccatagatgacattgtgttgacgatccttatctgcgaggttctgcttggttgg
cttaacggcttctggattttctggaaggatggctggaatatcctcaacttcgcaattgtc
tttatcttgtttatggggttcttcataaaacaacttgacatggttgccatcacctaccct
ctcagggtgctccggctggtgcatgtgtgtatggcggtggaacccctggccagaatcatc
aaggttatcctgcagtcgatgccagacttggctaatgtcatggctctcatcctcttcttc
atgctggtattctctgtgtttggggtcacgctcttcggtgcatttgtgcccaagcatttc
cagaacatgggggttgccctgtacacgctcttcatctgcatcactcaggatggatggctg
gacatctacactgacttccagatggatgaaagagagtacgcgatggaggtcgggggcgcc
atctactttgccgtctttatcaccctcggtgccttcattggtctcaacttgttcgtcgtc
gtggtgaccacaaacctggaacaaatgatgaagaccggcgaggaagagggacacctgaac
ataaagtttactgagacagaagaggatgaggactggaccgacgagctgccactggtgcat
tgtacagaggcccgcaaggatacttccactgtccccaaggaaccactggttgggggcccc
ctgagtaacctcacagaaaagacctgcgataacttctgcttggtgcttgaagcaatacag
gagaacttgatggagtacaaagagatccgagaggaactcaacatgatcgtggaggaagtg
tcctccatccggttcaaccaggagcagcaaaatgtgatcctacacaagtatacctccaaa
agcgccaccttcctaagcgagcccccagaaggggctaacaagcaagacttgatcactgcg
ctggtcagcagggaaaaggtgtctgattctaacataaacatggttaacaaacacaagttc
agccactga

DBGET integrated database retrieval system