KEGG   Mus musculus (mouse): 330474Help
Entry
330474            CDS       T01002                                 

Gene name
Zc3h4, Bwq1, Gm768, Kiaa1064-hp, mKIAA1064
Definition
(RefSeq) zinc finger CCCH-type containing 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 A2; 7 9.03 cM
AA seq 1255 aa AA seqDB search
MLRGREDGELEEGELEDDGAEEVQDPPGGQERSRKEKGEKHHSDSEEEKSHRRLKRKRKK
EREKEKRRSKKRRKSKHKRHASSSDDFSDFSDDSDFSPSEKSHRKYRDYSPPYAPSHQQY
SSSHNAPLPKKSYSKMDSKGYSMYEDYENEQYGEYEGDEEEDMGKEDYDDFTKELNQYRR
AKEGSSRGRGSRGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGEHPEDEEDLYEEEIE
YGESEEPMGDDDYDDYSKELNQYRRSKDSRGRGLSRGRGRGSRGGRGKGMGRGRGRGGRG
GMSKGGMNDDEDFYDDDMGDGGGGSYRRSDHDKPHQQSDKKGKVICKYFVEGRCTWGDHC
NFSHDIELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPL
TEETRELLDKMLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPGPPAPT
SPNGRPMQGGPPPPPPPPPPPPGPPQMSLPTHEPLSPQQLQQDMYNKKIPSLFEIVVRPT
GQLAEKLGVRFPGPGGPSGPMGPGPNMGPPGPMGGPMHPDMHPDMHPDMHPDMHPDMHPD
MHPDMHPDMHPDMPMGPGMNPGPPMGPGGPPMMPYGPGDSPHSGMMPPIPPAQNFYENFY
PQQEGMEMEPGLVGDAEDYGHYEELPGQPGEPLFPEHPLEPDSFPEGGPPGRPKAGAGVP
DFLPSAQRALYLRIQQKQQEEERARRLAESSKQDRENEEGDTGNWYSSDEDEGGSSVTSI
LKTLRQQTSSRPQASVGEPSSSGLGDPRLQKGHPTGSRLSDPRLSRDPRLSRHAETSGGS
GPGDSGPSDPRLARALPTSKAEGSLHSSPAGPSSSKGQPPAEEEEGERALREKAVNIPLD
PLPGHPLRDPRSQLQQFSHIKKDVTLSKPSFARTVLWNPEDLIPLPIPKQDVPPVPAALQ
SLPALDPRLHRSTPPGPPNTRQRPGSTDPSTSGSNLPDFELLSRILKTVNVNTPGQSEKP
SDPRVRKTPTDPRLQKPADPVAASRAAKPCPTEASPPAASPSGDSSPPATAPYDPRVLAA
GGLGQGSSSGQSSVLSGISLYDPRTPNAGGKTAEPASDTSAQPKGPEGNGKGSASKAKEP
PFVRKSALEQPETGKASTDGATATDRYNSYNRPRPKATAAPTAASSTPPPEGATPQPGVH
NLPVPTLFGTVKPAPKTGTGSPFAGNSPAREGEQDAGSLKDVFKGFDPTASPFCQ
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggggaagggaagatggtgagttggaagaaggtgaactggaagacgacggggct
gaggaggtccaggacccccctggaggacaagagaggagtcggaaggagaagggggagaag
caccacagcgactctgaggaggagaagtctcaccggaggctgaagcggaagcggaagaag
gagcgggagaaggaaaagaggcgctcgaagaaaaggcggaaatctaagcacaaacgccat
gcttcctccagcgatgacttctcggacttctcagatgactcagatttcagccccagtgag
aagagtcaccgcaagtaccgggactatagtcccccatacgcaccatcccaccagcagtac
tcctcgtcacacaacgcacccctgcccaagaagtcctactccaagatggatagcaagggc
tacagcatgtatgaggactacgagaatgagcagtatggggagtacgagggggatgaagag
gaggacatgggtaaggaagactatgacgacttcaccaaagaactgaaccagtaccggcgt
gccaaggagggcagcagccggggcagaggtagccgaggccgaggcaggggctacaggggc
cgtgggagtcgaggaggatctcgaggccgaggcatgggcaggggcagcagaggccgaggc
cgaggctccatgggagagcacccagaggacgaagaggacttgtatgaagaggagatagag
tatggagaaagtgaggagcccatgggagacgatgattacgatgactattccaaggagctg
aaccagtaccgcaggtccaaggacagccgaggtcgagggttgagtcgaggccgaggccgc
ggttcccgaggaggccgagggaaggggatgggccggggcagaggtcgaggcggcagaggt
ggaatgagcaagggcggaatgaatgatgacgaggacttctacgatgatgacatgggtgac
ggtggtggcggaagctaccggcggagtgatcatgacaagccccaccagcagtctgacaag
aaaggcaaagtcatctgcaaatactttgtggagggacgatgcacttggggagaccactgc
aattttagccacgacattgagctaccgaagaagcgagagttgtgcaaattttacatcacg
gggttctgtgctcgtgctgagaactgcccctacatgcatggtgactttccgtgtaaatta
taccacaccactgggaactgcatcaatggtgacgactgcatgttctcccatgacccgctg
acagaagagacacgagagctcctagataagatgttggctgatgatgcagaagcaggcgct
gaggacgagaaggaggtagaggagctgaagaagcagggcatcaaccctttgcccaagcca
cctcctggtgtagggctcctgcctactcctccacggccccctgggcctccagcccccacc
tctcctaatggcaggcccatgcaaggtggccctcctccaccaccaccacctcctccacca
cctcctggacctcctcagatgtccctgccaacacatgagccactgtctccacaacagtta
cagcaggacatgtacaacaagaagatcccctctttgtttgagattgtggtgcggcccacg
gggcagctagctgagaagctgggcgtgaggttccctggacctggtggaccctcggggcca
atgggtcctggccccaacatgggacccccagggccaatggggggacccatgcatcctgac
atgcaccctgacatgcacccagacatgcaccccgacatgcaccctgacatgcaccccgac
atgcaccccgacatgcaccctgacatgcatcctgacatgccaatgggtcctggcatgaac
cctggccctcccatgggtcctggtggccccccaatgatgccctatggtcctggagactcc
ccacattctggaatgatgcctcctatcccgccagcccagaacttctatgagaacttctac
ccgcagcaagagggcatggaaatggagcctggtcttgttggagatgcagaggactacggg
cactacgaagagctgccggggcagcctggggagcccctcttccctgagcaccctctggag
cctgacagcttccccgagggagggcccccaggccggccgaaggcaggcgccggtgtaccc
gacttcttgccctcggctcagagggccctgtacctgaggatccagcagaagcagcaggag
gaggagagagcgaggaggctggctgagagcagcaagcaggaccgggagaatgaggaaggt
gacactggaaactggtactcaagtgatgaggatgaagggggaagcagtgtcacatccatc
ctgaagaccttgaggcaacagacgtcaagccgaccccaggcttcagttggggaaccgagc
agcagtgggctgggggatccccgtctccagaagggacaccccacaggaagtcggctgtct
gacccccgcctcagccgggaccccagactcagccgccatgcagagacttcaggagggtct
ggcccaggggactcggggccctctgaccctcggttggctcgtgctctgcccacctccaag
gctgaaggcagccttcattccagccctgcaggccccagcagttcaaaaggacagccccct
gcagaagaggaggaaggggagagagccttgcgtgaaaaggcggtgaacattcccctggac
cctctgcctggacacccactacgggaccctcgctctcagctgcaacagttcagccacatc
aagaaggatgtgaccctgagcaagccgagctttgctcgcacagtgctctggaaccctgaa
gacctgatccccctgcccatccccaagcaggacgtgcccccagtgcctgctgccctgcag
tccctacctgctctagatcctaggctacaccgttccacaccccctgggcctccaaacacc
cggcagcgtccaggctccacagatcccagcacctctggctctaacctacctgactttgaa
ctcctctctcgaatcctcaagaccgtcaatgtcaatacccctggtcagagtgaaaagccc
agtgatccgagggtgcggaagacccctactgaccccagattacagaagccagcagatcct
gtggcagcctcccgtgcagccaagccctgtcccactgaagcatcgcctcctgctgccagc
ccaagcggggattcatccccaccggccacggctccctatgacccccgagtgctggctgct
ggtggcttgggccagggcagcagcagcgggcagagcagtgtgctgagtggtatcagctta
tatgacccaaggactcccaatgcaggtggcaaaactgcagagccagcttctgacacaagt
gctcagcccaagggtcctgagggcaatggcaagggctcagcctccaaggcaaaagagcct
ccgtttgtccgaaagtctgccctggagcagccagagacagggaaggccagcacagatggg
gccacagccacggacagatacaatagctacaaccggccccggcccaaggccacagcagcc
cccactgctgcctcatccaccccgccccctgagggggccacaccccagcctggggtacac
aacctgccagtgcccactctctttgggactgtaaagccggcccccaaaacaggcacaggg
agcccctttgctggcaacagccctgcccgtgagggtgagcaggatgcaggatccctgaag
gacgtttttaaaggctttgaccccacagcctcccccttctgccagtag

DBGET integrated database retrieval system