KEGG   Mus musculus (mouse): 330671Help
Entry
330671            CDS       T01002                                 

Gene name
B4galnt4, BC038881, Gm1095, beta4GalNAcT4
Definition
(RefSeq) beta-1,4-N-acetyl-galactosaminyl transferase 4 (EC:2.4.1.244)
  KO
K09657  
beta-1,4-N-acetylgalactosaminyltransferase 4 [EC:2.4.1.244]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.244  N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase
     330671 (B4galnt4)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Wide specificity
   330671 (B4galnt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7; 7 F5
AA seq 1034 aa AA seqDB search
MPWFPVKKVRKQMKLLLLLLLLTCAAWLTYVHRSLVRPGRALRQRLGYGRDGEKLTGVTD
SRGVRVPSSTQRSEDSSESHEEEQAPEGRGPNMLFPGGPRKPPPLNLTHQTPPWREEFKG
QVNLHVFEDWCGGAVGHLRRNLHFPLFPHTRTTVTKLAVSPKWKNYGLRIFGFIHPARDG
DIQFSVASDDNSEFWLSLDESPAAAQLVAFVGKTGSEWTAPGEFTKFSSQVSKPRRLMAS
RRYYFELLHKQDDKGSDHVEVGWRAFLPGLKFEIIDSAHISLYTDESSLKMDHVAHVPQS
PASHIGGFPPQGEPSADMLHPDPRDTFFLTPRMEPLSLENVLEPCAYAPTYILKDFPIAR
YQGLQFVYLSFIYPNDHTRLTHMETDNKCFYRESPLYLERFGFYKYMKMDKEEGEEDEEE
EVQRRAFLFLNPDDFLDEEDEQDLLDSLEPTDASVQQSHRTPTPAASTGTTASPTPPTTS
PLDEQTLRHSRALNWAPRPLPLFLGRAPPPRTVEKSPSKVYVTRVRPGQRASPRALRDSP
WPPFPGVFLRPKPLPRVQLRVPPHPPRTQGYRTSGPKVTELKPPVRAQTSQGGREGQLHG
QGLMVPTVDLNSSVETQPVTSFLSLSQVSRPQLPGEGEEGEEDGAPGDEATSEDSEEEEE
PAAGRPLGRWREDAINWQRTFSVGAMDFELLRSDWNDLRCNVSGNLQLPEAEAVDVVAQY
MERLNAKHGGRFSLLRIVNVEKRRDSARGSRFLLELELQERGGSRQRLSEYVFLRLPGAR
VGDEDGESPEPPPAASIHPDSRPELCRPLHLAWRQDVMVHFIVPVKNQARWVVQFLADMT
ALHVHTGDSYFNIILVDFESEDMDVERALRAAQLPRYQYLKRTGNFERSAGLQTGVDAVE
DPSSIVFLCDLHIHFPPNILDSIRKHCVEGKLAFAPVVMRLGCGSSPWDPHGYWEVNGFG
LFGIYKSDFDRVGGMNTEEFRDQWGGEDWELLDRVLQAGLEVERLRLRHFYHHYHSKRGM
WATRSRKGARAQRS
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggttcccggtgaagaaggtccgcaagcagatgaagctgctgctgctgttgctg
ctgctcacctgcgccgcgtggctcacgtatgtgcaccggagcctggtgcgcccgggccgc
gcgctacgccagcggctgggctacgggcgagatggggagaagctgaccggtgtgaccgat
agccgcggagtccgagtgccatcgtccacacagaggtcggaggactcgagtgaaagtcat
gaagaggagcaggcgcccgaggggcggggcccaaacatgctgtttcctggaggacctagg
aagccacccccactgaacctcacccaccagacacccccatggcgggaagagttcaaagga
caggtgaacctgcacgtgtttgaggactggtgtggaggtgctgtgggccacctgagacgg
aatctgcacttcccactctttcctcacactcgtactacggtgacaaagttagctgtgtcc
cctaagtggaagaactatggactccggatttttggcttcatccacccagccagagatgga
gacatccagttctctgtggcttcggatgacaactctgagttctggctgagtttggatgag
agcccagcagccgcccagcttgtagcctttgtgggcaagactggctccgagtggaccgca
cctggagaattcaccaagttcagctcccaggtgtctaagccacgtcggctcatggcctcc
cggagatactactttgaactgctccacaagcaagatgacaagggttcagaccatgtggaa
gtgggttggcgagctttcctgcctggtctgaagttcgagatcattgattctgctcacatt
tccctgtacacagatgagtcatctctgaagatggaccatgtggcccatgtgcctcagtct
ccagccagccacataggaggattcccgccgcagggggaacccagcgccgacatgctgcac
ccagaccccagggataccttcttcctcactcctcggatggaacctttgagcctggagaat
gttctggagccctgtgcctatgcccccacctatatcctcaaggatttccccatagccaga
taccaaggactacagtttgtgtacctgtccttcatctaccccaatgaccatacccgtctc
actcacatggagacagacaacaagtgcttctaccgtgagtccccactatacctggaaagg
tttgggttctataaatacatgaaaatggacaaggaggagggagaggaagatgaggaggaa
gaagttcagcgtagagccttcctcttcctcaacccagatgacttcctggatgaggaggat
gagcaggatctgttagacagcctggagcccaccgatgcatctgtacagcagagccacagg
acccccaccccagcagcctccactggaacgacagccagcccgaccccacctacaactagt
cctctggacgagcagaccctcagacactcccgggcactgaattgggccccacgccccctg
cccctcttcttggggcgagctccacctccccgaactgtggagaagtcgccttcaaaggtg
tacgtgaccagggtccgacctggacagcgggcttccccgagggcattgcgagactcaccc
tggccacccttccctggcgtcttcctgcgccccaagcctctgcccagagtacagctgcgg
gtacccccacatccacctcggacccagggctataggaccagtggccccaaggtcacagaa
ctaaagcccccagtcagggcccagaccagccagggaggccgggagggccagttacatgga
cagggactcatggtgcccacagtggacttgaactcctcagtggaaacacagcctgtgact
tccttcctgagcttgtctcaggtatccaggccacagctgccaggagagggtgaagaaggg
gaggaggatggggccccaggtgatgaggccacatcagaagacagtgaggaagaggaggag
ccggccgctgggcggcccctgggtcgctggcgggaggatgccatcaactggcagcgcacg
ttcagcgtgggcgccatggacttcgagctcctgcgctctgactggaacgacctgcgctgt
aacgtatccgggaacctgcaacttcctgaggccgaagcggtggatgtagtggctcagtac
atggagcggctaaatgcaaagcatggcgggcgcttctcgcttctacgcatcgtgaacgtg
gagaagcgccgcgactctgcacgcgggagccgcttcctcctggaactggaattgcaagag
cgcggagggagccgccagcgcctatccgaatacgtcttcctgcggttgcccggagcccgc
gttggggacgaagatggagaaagtcccgagccgcctccagccgcctcgatccacccagac
agtcgcccagagctctgccggcctttgcatctggcctggcgtcaggatgtcatggttcat
ttcattgtaccagtgaagaatcaggcgcgctgggtagtgcagttcctggcagatatgacc
gcgctgcatgtgcatacgggggactcgtacttcaacatcatcttggtggactttgagagc
gaggacatggatgtggagcgggccctgcgtgcggctcagctacctcggtaccagtacttg
aaacgaactggaaacttcgagcgctctgcaggcctgcaaactggagtggatgccgtggag
gaccccagcagcatcgttttcctctgtgacctgcacatccacttcccacctaatatcctg
gacagcatccgcaagcattgcgtggagggcaagctggccttcgcccctgtggtcatgcgt
ctgggctgtggaagctcaccgtgggacccacatggttactgggaagtgaatggatttggc
ctctttgggatctacaaatcagactttgacagagtaggaggcatgaacactgaggagttc
cgtgaccagtggggaggcgaggactgggaacttcttgacagggtcctgcaggcagggctg
gaggtggagaggcttcgactgcgacacttctaccaccactatcactcgaagcgaggcatg
tgggccacacgcagccgcaaaggtgcccgcgcacagcgatcctga

DBGET integrated database retrieval system