KEGG   Mus musculus (mouse): 330890Help
Entry
330890            CDS       T01002                                 

Gene name
Piwil4, 9230101H05Rik, Miwi2
Definition
(RefSeq) piwi-like RNA-mediated gene silencing 4
  KO
K02156  
aubergine
Organism
mmu  Mus musculus (mouse)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    330890 (Piwil4)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    330890 (Piwil4)
   piRNA pathway
    330890 (Piwil4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 A2
AA seq 878 aa AA seqDB search
MRLRILGVHRALPTHARVAVCSNYLGKLEYSQTPSHSHTVSFAKEKTLLLRLTSPGKPLA
PRNMSGRARVRARGITTGHSAREVGRSSRDLMVTSASPGDSEAGGGTSVISQPYELGVSS
GDGGRTFMERRGKGRQDFEELGVCTREKLTHVKDCKTGSSGIPVRLVTNLFNLDLPQDWQ
LYQYHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQKVTELTSETQRG
ETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSEPVEIPQYNKLL
FNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDW
SVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQMVHLMPE
LCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRTLPSSQEVLSHTSLP
LWAPEPGGLSSAIPLSTVLPFAQQLLTALSLSPGIPLPHLKPPSFLFLCQPAFAADWSKD
MRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDETPAAF
LRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVA
TKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSR
CVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLL
KSVTECGSDARYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQ
GLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcgcattctgggggtccaccgggccctgcccacccacgctcgggttgctgtt
tgtagtaactatcttgggaagcttgaatactcccaaactccgagtcacagccacaccgtc
tcttttgccaaagagaaaacactcctgttgaggctcaccagccctggaaagccgctggca
cccaggaacatgagtggacgggcccgtgtgagagcgcgaggcatcaccactggccacagt
gctagggaagtggggcggtcctcaagagacctcatggttacatctgccagtcctggggac
agcgaggccggaggtgggacaagtgtcatttcacagccatatgaacttggtgtctcttct
ggtgatggtggacgtaccttcatggaaagaagaggcaaaggcagacaggacttcgaagag
ttgggtgtctgtaccagggaaaagttgacccacgtaaaagattgtaaaacaggttctagc
ggaatacctgtgcggctggttacaaatctctttaatttagatttgccccaggattggcag
ctgtaccagtaccatgtcacgtacagcccagatttagcctctaggaggctgaggattgct
ttgctttataatcacagcatactctcagacaaggcaaaagcatttgacggtgccagcctt
ttcctctcagaaaagctggaccagaaggtcacagaactgacaagtgaaacacaaagaggt
gagactataaagataacgctcaccctaacgagcaagctcttcccaaactcccctgtgtgc
attcagttcttcaatgtcatcttcagaaagatcttgaaaaacttgagtatgtaccaaatt
ggacggaacttctataagccttcagaaccagtggagatccctcagtacaacaagctccta
ttcaatgctgacgtgaactacaaagtcctccgcaatgagaccgttctggacttcatgact
gatctctgcctcagaactggcatgtcttgcttcaccgagatgtgccacaaacaactagtg
gggctcgttgtccttaccagatacaacaacaaaacatatcgtatcgatgacattgactgg
tctgtgaagcccacacaggcctttcagaagcgggacggctcagaggtcacatatgtggat
tactacaagcagcaatatgatatcaccttatctgacctaaatcagccagtgcttgttagt
ctgttgaaaagaaagagaaatgataactctgagcctcagatggtccacctgatgccagag
ctctgctttctcacaggcctgagcagccaagcaacctcagatttccgcctgatgaaggca
gtagctgaagagactcggctcagtcctgtgggaaggcagcagcagctggcccgactcgtg
gatgacatccagagaaccttaccttcttctcaagaagttctctctcatacttccttgcct
ttgtgggccccagagccaggaggacttagcagtgctataccactgagcactgtgcttccc
tttgcccagcagctgttaactgccctgagcctctccccgggaatccctctgccccacctc
aagcctccctccttcctgttcttgtgtcaacctgcatttgctgctgactggtccaaagat
atgcgatcttgcaaagttttgagttctcagcctttgaatagatggttgatcgtgtgctgt
aacagggctgagcacttgattgaagcctttctgagctgtctgaggagagttggaggttcc
atgggatttaacgtgggctaccccaaaatcataaaagtggacgagaccccagcagcgttc
cttcgagccatccaggtgcacggcgaccccgatgttcagttggtgatgtgcattctgcct
tctaatcagaagaactattacgactccattaaaaagtatttgagctctgactgcccagtg
ccaagccagtgtgtgctgacccggaccttgaataagcagggaacgatgctgagtgtggcc
accaagatcgccatgcagatgacctgcaaacttggcggagagctgtggtctgtggagatc
ccattgaagtccctgatggtcgtgggtattgatatctgcagagatgccctcaacaagaat
gtggtggtcgtcgggtttgtagccagcattaattccaggatcaccaggtggttttcccgc
tgtgtccttcagagaacagcggctgatattgcagattgcctcaaagtctgcatgactggt
gctctcaaccggtggtacagacacaaccatgacttgccggcacggatagtcgtgtaccgg
gacggtgtaggcaatggccagctaaaggcagttttggaatatgaagtcccacagctactg
aaaagtgtaacagagtgcggctcggatgccaggtatgacttctacctgatcagccagact
gctaaccgggggactgttagtcccacccactacaacgttatctatgatgacaatgccttg
aagcctgaccacatgcagcgactgaccttcaaactgtgccatctctactacaactggcag
ggcttaatcagtgtccccgcaccatgccaatatgcacacaagctgaccttcctggtggca
caaagtgtccacaaggaaccaagtctggaattagccaataatcttttctacctctga

DBGET integrated database retrieval system