KEGG   Mus musculus (mouse): 332110Help
Entry
332110            CDS       T01002                                 

Gene name
Mapk15, BC048082
Definition
mitogen-activated protein kinase 15 (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     332110 (Mapk15)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   332110 (Mapk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 D3; 15
AA seq 549 aa AA seqDB search
MCAAEVDRHVAQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQIDAQRTFR
EIMLLKEFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLKDIHKRCIFY
QLLRATKFIHSGRVIHRDQKPANVLLDSACRVKLCDFGLARSLGDLPEGPGGQALTEYVA
TRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILKTIPLPSM
EELQDLGSDYSALILQNLGSRPQQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQAL
QHPYVQRFHCPDREWARESDVRLPVHEGDQLSAPEYRKRLYQIILEQSGNSRSPREEGLG
VVASRAELRASPARTQSLKSGVLPQVPAETPARKRGPKPPRSPGHDPEHVEVRRQSSDPL
FQLPPPGRGERPPGATGQPPSAPSGVKTQVRAMAPSLTSQAEAQAANQALIRSDPARGGG
PRAVGARRVPSRLPREAPEPRPGRRMFGISVSQGAQGAARAALGGYSQAYGTVCRSALGR
LPLLPGPRA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgccgaggtggaccgtcatgtagcccagagatacctgatcaagcggaggctt
gggaagggggcctatggcattgtgtggaaggccatggaccggaggactggcgaggttgtg
gccatcaagaaaatctttgatgcctttagggaccagatagatgctcagaggaccttccgt
gagattatgcttctcaaggagtttggaggccatcccaacatcatccgcctgcttgatgta
atcccagcgaagaatgacagggatatttacctggtgtttgagtccatggacaccgacctg
aatgcagtcatccagaagggcagactactgaaggacatccacaagcggtgcatcttttac
cagctcctgagagccaccaagtttatccattcagggcgcgtcatccatcgggatcagaag
ccagccaatgttctactggattctgcttgccgggtgaaactctgtgactttggcctggca
cgctccctcggtgacctccctgaggggcctgggggtcaggccctgacagagtatgtggcc
acacgctggtaccgagctccagaggtgcttctgtcttcccgatggtatacccctggggtg
gacatgtggagcctgggctgcatattaggagagatgcttcgagggcagccactgtttccc
gggacatctactttccaccagctggagctgatcctgaagaccatcccattgccttccatg
gaggagctccaggaccttggctcagactacagtgctttgattctgcagaatcttgggtcc
aggccacagcagacgctggacgccctcctgccgccagacacccccccagaagccctggac
ctcctcaagcgactcttggcgtttgctccggacaagcgccttagtgcagagcaggcgctg
caacacccctacgtgcagagattccattgccccgaccgcgagtgggcacgggagtccgac
gtgcggctcccggtgcacgaaggagaccagctctctgcaccagagtatcgcaaacgcctg
taccagattatcctggagcaaagtgggaacagccgcagccctcgagaggaaggcctgggg
gttgtggcctcgcgggctgagctcagggcttccccggcccggacgcaatcgctcaagtcg
ggagtcctcccccaggtcccggcggagacgccagcgcgaaaacgcggacccaaacctccg
cgtagccctggtcatgatcctgagcatgtggaagttcgcaggcagagctcagaccccctg
ttccaacttccgccgccaggaaggggggaaaggcccccaggggccacagggcagccaccc
tcggcaccctcaggggtgaagactcaagtgagggcgatggcgccgtccctgacttcacag
gcagaggctcaggcggccaatcaggctctgatccgcagtgatccggcccggggcggtggg
ccgagggcggtcggcgcgcgacgggtcccttcccgcctgccccgggaggccccggaaccc
cgacccggccgaaggatgtttggcatctcggtctcgcagggggcccagggcgcagccaga
gctgcgcttggcggctactcccaggcctacgggaccgtgtgccgctcggcgctgggccgc
ctgcccctgctccccggaccgcgtgcgtga

DBGET integrated database retrieval system