KEGG   Mus musculus (mouse): 332396Help
Entry
332396            CDS       T01002                                 

Gene name
Kcnk18, Gm781, Tresk, Tresk-2, Trik
Definition
(RefSeq) potassium channel, subfamily K, member 18
  KO
K20007  
potassium channel subfamily K member 18
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   332396 (Kcnk18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 D3
AA seq 394 aa AA seqDB search
MEAEEPPEARRCCPEALGKARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVEGRPD
PEAEENPELKKFLDDLCNILKCNLTVVEGSRKNLCEHLQHLKPQWLKAPQDWSFLSALFF
CCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQAL
LCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELF
ERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIAL
VVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIVLVHPHFFLFFSIYIIVGM
EILFIAFKLMQNRLLHTYKTLMLFVCQREVSLPW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgaggagccacctgaggccaggagatgctgtcccgaggccctggggaaggcc
aggggatgctgccccgaagccctgggcaagcttctgcccggcctctgcttcctttgctgc
ctggtgacctatgcgctggtgggtgctgctctcttctccgctgtcgagggccgccctgac
ccagaagcagaggagaaccctgagttgaagaagttcctggacgatctgtgcaacatcctg
aaatgtaacctgacagtggttgaaggtagcaggaagaacttgtgtgagcatctgcaacac
ctcaagccccagtggctcaaggcgccccaggactggtccttcctgagcgctctcttcttc
tgctgcacagtgttcagcacagtgggttatggccacatgtaccctgtcaccaggctcggt
aagttcctgtgcatgctgtatgcgctctttggaatccctctaatgttcctggtcctcaca
gacataggagatatcctggccaccatcttatccagggcttacagtcggttccaggctctc
ctttgcctcccccacgatatcttcaaatggcgctccctcccgctctgccggaagcagcct
gacagcaaaccggtggaggaagccatccctcagattgtcattgatgctggtgtggatgaa
ctcctaaacccgcagcccagcaaggaccccccctctccgagctgcaatgtggagctgttt
gagagattagttgcccgtgagaaaaagaacaagctacaaccacccacgcgtcccgtggag
aggagcaactcctgtcccgagctggtgctggggcgactgtcctgttctattctcagcaat
ctggatgaagtgggccagcaggtggagaggctggacatccctctccccgtcatcgccctg
gtcgtctttgcatacatctcctgcgcggctgctatcctccccttctgggagaccgagcta
ggcttcgaggatgctttctacttctgctttgtgacactgaccaccatcgggtttggggac
atcgtgctggtgcaccctcatttcttcctcttcttctccatctacatcatcgtgggcatg
gagatcctgttcattgccttcaagctgatgcagaaccggctcctgcacacctacaaaacc
ctcatgctgtttgtttgccaaagggaagtttcgctaccttggtaa

DBGET integrated database retrieval system