KEGG   Mus musculus (mouse): 338374Help
Entry
338374            CDS       T01002                                 

Gene name
Ifnl3, IFL-1, IL-28B, INF-alpha, INF-lambda, Il28, Il28b
Definition
(RefSeq) interferon lambda 3
  KO
K05447  
interleukin 28/29 (interferon lambda)
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    338374 (Ifnl3)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    338374 (Ifnl3)
Cytokines [BR:mmu04052]
 Class II cytokines (interferon/IL-10 family)
  Type III interferons
   338374 (Ifnl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 B1
AA seq 193 aa AA seqDB search
MLLLLLPLLLAAVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEK
RLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLH
TLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLL
RDLKCVASGDQCV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcctgctgttgcctctgctgctggccgcagtgctgacaagaacccaagctgac
cctgtccccagggccaccaggctcccagtggaagcaaaggattgccacattgctcagttc
aagtctctgtccccaaaagagctgcaggccttcaaaaaggccaagggtgccatcgagaag
aggctgcttgagaaggacatgaggtgcagttcccacctcatctccagggcctgggacctg
aagcagctgcaggtccaagagcgccccaaggccttgcaggctgaggtggccctgaccctg
aaggtctgggagaacataaatgactcagccctgaccaccatcctgggccagcctcttcat
acactgagccacattcactcccagctgcagacctgtacacagcttcaggccacagcagag
cccaagcccccgagtcgccgcctctcccgctggctgcacaggctccaggaggcccagagc
aaggagactcctggctgcctggaggactctgtcacctccaacctgtttcaactgctcctc
cgggacctcaagtgtgtggccagtggagaccagtgtgtctga

DBGET integrated database retrieval system